Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BIC8

Protein Details
Accession A0A0H1BIC8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-122GDFCLIPTRTDRRRRLRRRPRRLHPRLFEKBasic
NLS Segment(s)
PositionSequence
104-122RRRRLRRRPRRLHPRLFEK
Subcellular Location(s) plas 13, mito 4, extr 4, E.R. 3, nucl 1, cyto 1, cyto_nucl 1, golg 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR012506  TMEM86B-like  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF07947  YhhN  
Amino Acid Sequences MPSLSTLLPPFLSNLSLPPPQTIGLVNLSLPLLVLSERFSFYPGSYIFKLLSSAAFLGGPLYYLAPASSPWQWQQWDPYHLRIAAGLVFSAIGDFCLIPTRTDRRRRLRRRPRRLHPRLFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.2
5 0.19
6 0.2
7 0.19
8 0.19
9 0.18
10 0.15
11 0.14
12 0.14
13 0.13
14 0.12
15 0.11
16 0.1
17 0.09
18 0.07
19 0.05
20 0.04
21 0.05
22 0.06
23 0.08
24 0.09
25 0.09
26 0.1
27 0.11
28 0.11
29 0.14
30 0.13
31 0.16
32 0.16
33 0.17
34 0.16
35 0.16
36 0.16
37 0.12
38 0.12
39 0.08
40 0.07
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.06
55 0.07
56 0.09
57 0.1
58 0.14
59 0.15
60 0.16
61 0.22
62 0.25
63 0.3
64 0.3
65 0.32
66 0.32
67 0.31
68 0.3
69 0.23
70 0.19
71 0.14
72 0.12
73 0.09
74 0.06
75 0.06
76 0.05
77 0.05
78 0.04
79 0.03
80 0.04
81 0.04
82 0.04
83 0.1
84 0.11
85 0.12
86 0.17
87 0.26
88 0.35
89 0.45
90 0.55
91 0.6
92 0.71
93 0.81
94 0.88
95 0.91
96 0.93
97 0.94
98 0.96
99 0.96
100 0.96
101 0.96
102 0.96