Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BG42

Protein Details
Accession A0A0H1BG42    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAPNLRPRSNYRRGRRPTAKIPLPRHydrophilic
46-88LPLPHPPRPRRHLQRHRHLRPQTRCGLAPQKRRPLHHRPDHRHBasic
NLS Segment(s)
PositionSequence
8-87RSNYRRGRRPTAKIPLPRLPRDPRRIPLSALSRPQGRFLPLPHPPRPRRHLQRHRHLRPQTRCGLAPQKRRPLHHRPDHR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAPNLRPRSNYRRGRRPTAKIPLPRLPRDPRRIPLSALSRPQGRFLPLPHPPRPRRHLQRHRHLRPQTRCGLAPQKRRPLHHRPDHRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.84
4 0.83
5 0.83
6 0.82
7 0.79
8 0.79
9 0.77
10 0.75
11 0.71
12 0.69
13 0.68
14 0.69
15 0.69
16 0.68
17 0.65
18 0.64
19 0.61
20 0.55
21 0.52
22 0.5
23 0.46
24 0.42
25 0.39
26 0.38
27 0.36
28 0.36
29 0.3
30 0.26
31 0.23
32 0.21
33 0.25
34 0.28
35 0.34
36 0.39
37 0.48
38 0.51
39 0.58
40 0.62
41 0.66
42 0.69
43 0.74
44 0.77
45 0.78
46 0.84
47 0.87
48 0.9
49 0.89
50 0.88
51 0.87
52 0.85
53 0.83
54 0.78
55 0.72
56 0.65
57 0.62
58 0.63
59 0.62
60 0.64
61 0.65
62 0.69
63 0.7
64 0.76
65 0.77
66 0.78
67 0.8
68 0.8