Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BK83

Protein Details
Accession A0A0H1BK83   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-35ASETTRGKRKRTSSRTRRRNPGNSTARKKRRVSNHydrophilic
NLS Segment(s)
PositionSequence
7-32RGKRKRTSSRTRRRNPGNSTARKKRR
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MASETTRGKRKRTSSRTRRRNPGNSTARKKRRVSNSDIAGGGTGTRLPRELRRALEKQNAVKEKLGDSSLEAIRTETQGPPPGYVFVPKGDVYITRNCRSLSHEAKQTVYTVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.92
4 0.93
5 0.93
6 0.92
7 0.91
8 0.88
9 0.87
10 0.87
11 0.86
12 0.86
13 0.87
14 0.86
15 0.85
16 0.82
17 0.79
18 0.79
19 0.75
20 0.74
21 0.72
22 0.67
23 0.61
24 0.57
25 0.48
26 0.37
27 0.3
28 0.21
29 0.12
30 0.09
31 0.06
32 0.06
33 0.07
34 0.09
35 0.13
36 0.18
37 0.22
38 0.24
39 0.31
40 0.34
41 0.38
42 0.43
43 0.43
44 0.42
45 0.46
46 0.45
47 0.4
48 0.38
49 0.33
50 0.28
51 0.25
52 0.22
53 0.15
54 0.12
55 0.15
56 0.15
57 0.14
58 0.13
59 0.13
60 0.13
61 0.14
62 0.15
63 0.11
64 0.14
65 0.2
66 0.2
67 0.21
68 0.21
69 0.21
70 0.2
71 0.22
72 0.2
73 0.14
74 0.17
75 0.16
76 0.16
77 0.15
78 0.16
79 0.17
80 0.26
81 0.31
82 0.31
83 0.34
84 0.35
85 0.35
86 0.39
87 0.45
88 0.44
89 0.45
90 0.5
91 0.49
92 0.51
93 0.51