Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BRL8

Protein Details
Accession A0A0H1BRL8    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-33LSTRRAARRGSQRRRDTRASRHydrophilic
NLS Segment(s)
PositionSequence
17-30RAARRGSQRRRDTR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MADKLDKSLDDILSTRRAARRGSQRRRDTRASRASQNAAPVGGVKKTVRNAKSTSKATPTGPSMGLGESKIIVSGLPSDVNEANIKVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.28
5 0.29
6 0.36
7 0.43
8 0.5
9 0.6
10 0.66
11 0.73
12 0.79
13 0.84
14 0.85
15 0.79
16 0.78
17 0.77
18 0.71
19 0.66
20 0.62
21 0.58
22 0.5
23 0.46
24 0.36
25 0.26
26 0.21
27 0.17
28 0.14
29 0.1
30 0.11
31 0.09
32 0.11
33 0.16
34 0.23
35 0.23
36 0.26
37 0.3
38 0.36
39 0.43
40 0.44
41 0.43
42 0.41
43 0.42
44 0.39
45 0.39
46 0.34
47 0.29
48 0.26
49 0.23
50 0.19
51 0.18
52 0.17
53 0.13
54 0.11
55 0.09
56 0.09
57 0.08
58 0.07
59 0.06
60 0.06
61 0.07
62 0.08
63 0.09
64 0.09
65 0.13
66 0.13
67 0.16
68 0.17