Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BSA5

Protein Details
Accession A0A0H1BSA5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
349-369FYRFYSKRKLRKSMDVRDKARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTNSNSSSERADQYDPVSPIDIVHSTHSKSAGLSISVQKEPSEKAYHPAAPSLKSPRTTRFAEVTTFHSPIDPPGHSPFVDPPSMSQTNQQTQVSDLGFGYMADSQPSQTPEQSQTAAGRNPPNSPLKSALKSPGAPGRSAMLSPTFREEQILEHHEKTAEKANAKDIKIKARVRLAKVMLRGVSFSCSLIILALVAASFMIFNATRGLAQKNSFTPWAPNTPLWPQILVLSFACVSLLCCVAVFYGYWRGGHKRAEKVAVYYTVFSVLFFIVILVMWVVGAAVLQNSRNSTSNKDMWGWACNPGTRRDLYKEHVDYELVCRMQDWALVCCVIEVVIEVLVISIYAVIFYRFYSKRKLRKSMDVRDKARSDLYLAHLRSQSAPNTPGFPRHGPASPPMSPSPMKGDYYAAAEEGYSTQYATPQTPESTHMGTSQPFQLRPPPIRVQDATPKLSQEGFNMPMSPATLERRNEHVAAAPGEQKYESVPIPGAYATPLTSPTFAPETRGSDVIPGMAVTTTERIVPSRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.32
4 0.3
5 0.26
6 0.24
7 0.25
8 0.23
9 0.17
10 0.21
11 0.23
12 0.23
13 0.26
14 0.26
15 0.24
16 0.22
17 0.25
18 0.23
19 0.2
20 0.23
21 0.27
22 0.3
23 0.32
24 0.32
25 0.29
26 0.29
27 0.3
28 0.32
29 0.31
30 0.27
31 0.3
32 0.36
33 0.4
34 0.38
35 0.42
36 0.4
37 0.36
38 0.41
39 0.46
40 0.45
41 0.45
42 0.49
43 0.49
44 0.51
45 0.53
46 0.52
47 0.49
48 0.46
49 0.44
50 0.42
51 0.41
52 0.41
53 0.38
54 0.32
55 0.28
56 0.26
57 0.26
58 0.29
59 0.24
60 0.23
61 0.27
62 0.29
63 0.28
64 0.3
65 0.31
66 0.29
67 0.3
68 0.27
69 0.24
70 0.29
71 0.32
72 0.3
73 0.31
74 0.35
75 0.38
76 0.43
77 0.42
78 0.34
79 0.33
80 0.37
81 0.31
82 0.25
83 0.19
84 0.14
85 0.14
86 0.13
87 0.12
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.12
94 0.16
95 0.16
96 0.16
97 0.2
98 0.23
99 0.26
100 0.26
101 0.25
102 0.26
103 0.28
104 0.3
105 0.31
106 0.33
107 0.32
108 0.33
109 0.36
110 0.4
111 0.37
112 0.38
113 0.39
114 0.4
115 0.41
116 0.42
117 0.42
118 0.4
119 0.39
120 0.39
121 0.39
122 0.34
123 0.32
124 0.29
125 0.26
126 0.22
127 0.21
128 0.19
129 0.17
130 0.17
131 0.18
132 0.22
133 0.21
134 0.2
135 0.21
136 0.2
137 0.17
138 0.22
139 0.27
140 0.25
141 0.25
142 0.26
143 0.26
144 0.26
145 0.26
146 0.28
147 0.27
148 0.26
149 0.26
150 0.34
151 0.39
152 0.4
153 0.45
154 0.39
155 0.44
156 0.5
157 0.52
158 0.48
159 0.51
160 0.56
161 0.53
162 0.57
163 0.52
164 0.48
165 0.47
166 0.45
167 0.37
168 0.31
169 0.28
170 0.21
171 0.19
172 0.16
173 0.13
174 0.1
175 0.09
176 0.08
177 0.07
178 0.07
179 0.04
180 0.04
181 0.03
182 0.03
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.04
189 0.04
190 0.04
191 0.05
192 0.06
193 0.07
194 0.09
195 0.11
196 0.12
197 0.14
198 0.16
199 0.17
200 0.19
201 0.19
202 0.18
203 0.19
204 0.19
205 0.23
206 0.23
207 0.22
208 0.23
209 0.24
210 0.27
211 0.24
212 0.21
213 0.17
214 0.16
215 0.17
216 0.15
217 0.13
218 0.1
219 0.09
220 0.09
221 0.09
222 0.06
223 0.06
224 0.05
225 0.06
226 0.05
227 0.04
228 0.05
229 0.05
230 0.05
231 0.04
232 0.05
233 0.09
234 0.1
235 0.11
236 0.12
237 0.15
238 0.18
239 0.25
240 0.29
241 0.29
242 0.31
243 0.35
244 0.33
245 0.32
246 0.31
247 0.28
248 0.23
249 0.18
250 0.16
251 0.13
252 0.13
253 0.11
254 0.09
255 0.06
256 0.06
257 0.05
258 0.05
259 0.03
260 0.03
261 0.03
262 0.02
263 0.02
264 0.02
265 0.02
266 0.02
267 0.02
268 0.02
269 0.02
270 0.02
271 0.03
272 0.04
273 0.05
274 0.06
275 0.08
276 0.11
277 0.12
278 0.16
279 0.21
280 0.23
281 0.24
282 0.25
283 0.25
284 0.23
285 0.25
286 0.22
287 0.22
288 0.2
289 0.21
290 0.21
291 0.23
292 0.25
293 0.23
294 0.25
295 0.25
296 0.28
297 0.29
298 0.36
299 0.34
300 0.33
301 0.32
302 0.3
303 0.25
304 0.25
305 0.25
306 0.17
307 0.15
308 0.13
309 0.14
310 0.13
311 0.14
312 0.13
313 0.09
314 0.1
315 0.1
316 0.1
317 0.08
318 0.08
319 0.06
320 0.05
321 0.04
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.02
331 0.02
332 0.03
333 0.03
334 0.03
335 0.04
336 0.04
337 0.12
338 0.14
339 0.16
340 0.26
341 0.35
342 0.44
343 0.53
344 0.63
345 0.62
346 0.7
347 0.78
348 0.79
349 0.82
350 0.82
351 0.77
352 0.75
353 0.7
354 0.62
355 0.53
356 0.43
357 0.33
358 0.27
359 0.29
360 0.29
361 0.28
362 0.3
363 0.3
364 0.3
365 0.31
366 0.31
367 0.28
368 0.24
369 0.26
370 0.23
371 0.26
372 0.26
373 0.29
374 0.3
375 0.3
376 0.28
377 0.29
378 0.3
379 0.28
380 0.32
381 0.34
382 0.31
383 0.33
384 0.32
385 0.34
386 0.32
387 0.31
388 0.33
389 0.3
390 0.28
391 0.25
392 0.26
393 0.22
394 0.25
395 0.23
396 0.17
397 0.13
398 0.12
399 0.11
400 0.1
401 0.1
402 0.07
403 0.07
404 0.07
405 0.1
406 0.12
407 0.12
408 0.14
409 0.15
410 0.17
411 0.18
412 0.21
413 0.23
414 0.23
415 0.22
416 0.22
417 0.22
418 0.21
419 0.22
420 0.26
421 0.26
422 0.25
423 0.27
424 0.32
425 0.38
426 0.41
427 0.46
428 0.47
429 0.47
430 0.53
431 0.53
432 0.51
433 0.54
434 0.56
435 0.53
436 0.46
437 0.43
438 0.39
439 0.4
440 0.34
441 0.28
442 0.27
443 0.26
444 0.26
445 0.25
446 0.24
447 0.22
448 0.21
449 0.19
450 0.17
451 0.19
452 0.25
453 0.27
454 0.3
455 0.36
456 0.39
457 0.38
458 0.36
459 0.35
460 0.33
461 0.32
462 0.31
463 0.3
464 0.26
465 0.27
466 0.26
467 0.22
468 0.19
469 0.2
470 0.18
471 0.15
472 0.16
473 0.15
474 0.17
475 0.16
476 0.15
477 0.12
478 0.13
479 0.11
480 0.11
481 0.13
482 0.14
483 0.15
484 0.15
485 0.18
486 0.22
487 0.21
488 0.25
489 0.27
490 0.31
491 0.33
492 0.34
493 0.3
494 0.27
495 0.28
496 0.23
497 0.19
498 0.13
499 0.11
500 0.1
501 0.1
502 0.09
503 0.11
504 0.11
505 0.12
506 0.13
507 0.14