Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BBI2

Protein Details
Accession A0A0H1BBI2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21PYGRQRISSPHRSRQPQHNAVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences PYGRQRISSPHRSRQPQHNAVATQPQTHPERPSSISIRPQTHSRLYSRFPIVSVTIGAVGRRYIPRRARNIPPPPLLELGIKRVSPEQHLKKTVLSLSPFARQWADKRRLSRTPIRRSFCSVTSCGTWQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.79
4 0.76
5 0.73
6 0.64
7 0.58
8 0.6
9 0.51
10 0.44
11 0.37
12 0.36
13 0.34
14 0.36
15 0.37
16 0.3
17 0.33
18 0.33
19 0.38
20 0.37
21 0.37
22 0.42
23 0.45
24 0.46
25 0.44
26 0.45
27 0.44
28 0.45
29 0.44
30 0.39
31 0.38
32 0.36
33 0.4
34 0.39
35 0.35
36 0.29
37 0.27
38 0.24
39 0.2
40 0.17
41 0.11
42 0.1
43 0.09
44 0.09
45 0.08
46 0.07
47 0.08
48 0.11
49 0.14
50 0.2
51 0.27
52 0.34
53 0.41
54 0.47
55 0.52
56 0.58
57 0.64
58 0.64
59 0.59
60 0.54
61 0.49
62 0.45
63 0.39
64 0.32
65 0.24
66 0.22
67 0.21
68 0.19
69 0.18
70 0.19
71 0.19
72 0.22
73 0.31
74 0.34
75 0.39
76 0.43
77 0.43
78 0.42
79 0.44
80 0.41
81 0.36
82 0.3
83 0.26
84 0.26
85 0.29
86 0.29
87 0.27
88 0.27
89 0.24
90 0.29
91 0.36
92 0.42
93 0.43
94 0.48
95 0.55
96 0.59
97 0.64
98 0.68
99 0.68
100 0.71
101 0.75
102 0.76
103 0.72
104 0.73
105 0.71
106 0.66
107 0.61
108 0.52
109 0.46
110 0.43