Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BV05

Protein Details
Accession A0A0H1BV05    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-111SRDERRQRSRSRDRDGRRRDRSRSRDRRDRSRSRSRERRDRDRDRDRAGRRDRDTBasic
NLS Segment(s)
PositionSequence
54-113SNASRDERRQRSRSRDRDGRRRDRSRSRDRRDRSRSRSRERRDRDRDRDRAGRRDRDTRR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAEPPAKRARRTDSSTMWEMNDSKSLAGDHDSNEVDGGISRREAASTRDDIKRSNASRDERRQRSRSRDRDGRRRDRSRSRDRRDRSRSRSRERRDRDRDRDRAGRRDRDTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.58
4 0.5
5 0.44
6 0.38
7 0.31
8 0.28
9 0.21
10 0.17
11 0.16
12 0.16
13 0.13
14 0.14
15 0.14
16 0.12
17 0.15
18 0.15
19 0.14
20 0.14
21 0.13
22 0.1
23 0.1
24 0.1
25 0.07
26 0.07
27 0.07
28 0.07
29 0.08
30 0.09
31 0.1
32 0.13
33 0.16
34 0.2
35 0.24
36 0.25
37 0.25
38 0.28
39 0.33
40 0.31
41 0.33
42 0.35
43 0.37
44 0.45
45 0.53
46 0.6
47 0.61
48 0.67
49 0.69
50 0.7
51 0.75
52 0.77
53 0.77
54 0.76
55 0.77
56 0.78
57 0.82
58 0.85
59 0.85
60 0.85
61 0.84
62 0.84
63 0.85
64 0.86
65 0.87
66 0.87
67 0.87
68 0.87
69 0.86
70 0.88
71 0.88
72 0.89
73 0.86
74 0.87
75 0.87
76 0.87
77 0.9
78 0.89
79 0.9
80 0.88
81 0.9
82 0.9
83 0.91
84 0.9
85 0.9
86 0.89
87 0.87
88 0.87
89 0.84
90 0.84
91 0.82
92 0.82
93 0.78