Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B7S6

Protein Details
Accession A0A0H1B7S6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
72-95GEWKMFKDITQKEKKKQCKPKYKVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.5, cyto 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MILDLKDTTILPLLEKHLEWRVQDLTGKVVDAGELIGTSTGHSRGLEITLAERDVSPLAADDKERDHFPILGEWKMFKDITQKEKKKQCKPKYKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.22
5 0.25
6 0.24
7 0.26
8 0.25
9 0.24
10 0.26
11 0.23
12 0.21
13 0.18
14 0.18
15 0.13
16 0.12
17 0.1
18 0.07
19 0.07
20 0.04
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.06
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.06
46 0.07
47 0.08
48 0.08
49 0.11
50 0.13
51 0.14
52 0.15
53 0.16
54 0.16
55 0.16
56 0.22
57 0.22
58 0.22
59 0.22
60 0.22
61 0.21
62 0.23
63 0.22
64 0.17
65 0.23
66 0.28
67 0.38
68 0.48
69 0.55
70 0.61
71 0.72
72 0.81
73 0.83
74 0.87
75 0.88