Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1B7Y9

Protein Details
Accession A0A0H1B7Y9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRCARRPRHPRPRPEIRRGQGIHBasic
NLS Segment(s)
PositionSequence
5-20RRPRHPRPRPEIRRGQ
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MRCARRPRHPRPRPEIRRGQGIHGRVRFPHHHQGCLWWRRTWYASCQGTGDPTRLLRARDLRSQVRVRQWYRLRGTLPGQTEAHRSAIAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.82
4 0.83
5 0.74
6 0.72
7 0.67
8 0.62
9 0.6
10 0.53
11 0.5
12 0.41
13 0.46
14 0.43
15 0.43
16 0.48
17 0.42
18 0.42
19 0.4
20 0.46
21 0.5
22 0.52
23 0.48
24 0.39
25 0.38
26 0.38
27 0.41
28 0.34
29 0.3
30 0.32
31 0.3
32 0.29
33 0.29
34 0.26
35 0.27
36 0.26
37 0.22
38 0.13
39 0.12
40 0.16
41 0.16
42 0.17
43 0.19
44 0.26
45 0.29
46 0.34
47 0.4
48 0.4
49 0.46
50 0.51
51 0.52
52 0.53
53 0.58
54 0.54
55 0.58
56 0.61
57 0.62
58 0.62
59 0.62
60 0.55
61 0.51
62 0.53
63 0.49
64 0.46
65 0.42
66 0.38
67 0.34
68 0.37
69 0.34
70 0.32
71 0.25