Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BKV4

Protein Details
Accession A0A0H1BKV4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-117QVEQGMPSSRKRKKRKCKLANRSLHydrophilic
NLS Segment(s)
PositionSequence
102-111SRKRKKRKCK
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MVAQVVFELISGRPVPTCFSGEAAPTAEREDEGQHESGADEQSINHDSKRACWTWDENDRLIALKKDGFDWSELADRLPGRTIGSLRQRWYAHQVEQGMPSSRKRKKRKCKLANRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.16
4 0.19
5 0.16
6 0.18
7 0.18
8 0.18
9 0.19
10 0.18
11 0.16
12 0.14
13 0.15
14 0.13
15 0.12
16 0.12
17 0.12
18 0.12
19 0.14
20 0.14
21 0.13
22 0.13
23 0.13
24 0.13
25 0.12
26 0.1
27 0.07
28 0.06
29 0.09
30 0.11
31 0.12
32 0.1
33 0.13
34 0.13
35 0.17
36 0.22
37 0.2
38 0.19
39 0.21
40 0.25
41 0.27
42 0.35
43 0.34
44 0.29
45 0.29
46 0.28
47 0.26
48 0.24
49 0.18
50 0.12
51 0.1
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.14
60 0.13
61 0.12
62 0.14
63 0.13
64 0.13
65 0.13
66 0.12
67 0.1
68 0.12
69 0.13
70 0.18
71 0.27
72 0.31
73 0.32
74 0.38
75 0.38
76 0.39
77 0.46
78 0.43
79 0.38
80 0.39
81 0.39
82 0.35
83 0.37
84 0.38
85 0.36
86 0.34
87 0.38
88 0.43
89 0.48
90 0.56
91 0.65
92 0.72
93 0.78
94 0.87
95 0.91
96 0.92
97 0.95