Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BBH5

Protein Details
Accession A0A0H1BBH5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-33PYISNCKRELSKRTKKPRRLQEKLLDLFHydrophilic
NLS Segment(s)
PositionSequence
17-24KRTKKPRR
Subcellular Location(s) mito 10.5, nucl 7, cyto_mito 6.5, plas 4, golg 4
Family & Domain DBs
Amino Acid Sequences MASFFPYISNCKRELSKRTKKPRRLQEKLLDLFVPLSLVALKAGLRLVMENGLRNHENEECGWRLKSVRSSPRQISPCTPASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.6
4 0.67
5 0.77
6 0.84
7 0.88
8 0.91
9 0.91
10 0.92
11 0.88
12 0.87
13 0.85
14 0.84
15 0.76
16 0.67
17 0.56
18 0.45
19 0.37
20 0.28
21 0.18
22 0.08
23 0.06
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.07
36 0.08
37 0.11
38 0.12
39 0.16
40 0.16
41 0.17
42 0.19
43 0.17
44 0.18
45 0.16
46 0.19
47 0.18
48 0.2
49 0.2
50 0.19
51 0.2
52 0.23
53 0.31
54 0.36
55 0.44
56 0.49
57 0.56
58 0.6
59 0.68
60 0.68
61 0.65
62 0.61
63 0.57