Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B981

Protein Details
Accession A0A0H1B981    Localization Confidence High Confidence Score 20.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-46ARDYNVKKAKLQRLREKARDRNPDEFAHydrophilic
160-179FGEKQKQAPKKKKEIEAEERBasic
185-204LAARRLKKRAAEVRRKKVEABasic
NLS Segment(s)
PositionSequence
164-201QKQAPKKKKEIEAEERARKEMLAARRLKKRAAEVRRKK
239-247KWKIRERKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MGYPRETQGENFIFDYSLRARDYNVKKAKLQRLREKARDRNPDEFAFGMMSEKSNRQGRHGARGSEAATLSHEAIKLLKTQDAGYLRVVGEKVRRQLEGVEQEVRLQDGMNGVLQGDTGRKIVFADSLEEQRRLRIQRGETKDEDADSEEEQFEDGEASFGEKQKQAPKKKKEIEAEERARKEMLAARRLKKRAAEVRRKKVEALQIQHKELVAAEQELDRQRAKMENSVGGVNKDGIKWKIRERKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.19
4 0.2
5 0.2
6 0.19
7 0.21
8 0.31
9 0.38
10 0.44
11 0.5
12 0.5
13 0.55
14 0.65
15 0.73
16 0.72
17 0.75
18 0.76
19 0.78
20 0.84
21 0.87
22 0.88
23 0.87
24 0.88
25 0.88
26 0.84
27 0.8
28 0.76
29 0.67
30 0.59
31 0.5
32 0.4
33 0.3
34 0.24
35 0.18
36 0.13
37 0.13
38 0.12
39 0.14
40 0.19
41 0.25
42 0.26
43 0.29
44 0.37
45 0.39
46 0.47
47 0.51
48 0.46
49 0.41
50 0.44
51 0.4
52 0.34
53 0.31
54 0.21
55 0.17
56 0.16
57 0.15
58 0.13
59 0.12
60 0.1
61 0.11
62 0.11
63 0.13
64 0.12
65 0.13
66 0.13
67 0.13
68 0.18
69 0.19
70 0.2
71 0.18
72 0.19
73 0.17
74 0.17
75 0.17
76 0.14
77 0.17
78 0.2
79 0.25
80 0.25
81 0.25
82 0.24
83 0.25
84 0.3
85 0.29
86 0.27
87 0.24
88 0.22
89 0.23
90 0.22
91 0.21
92 0.14
93 0.1
94 0.07
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.09
114 0.14
115 0.16
116 0.17
117 0.17
118 0.17
119 0.21
120 0.21
121 0.24
122 0.24
123 0.28
124 0.36
125 0.42
126 0.47
127 0.44
128 0.45
129 0.41
130 0.36
131 0.31
132 0.24
133 0.19
134 0.13
135 0.13
136 0.1
137 0.09
138 0.09
139 0.08
140 0.07
141 0.06
142 0.05
143 0.04
144 0.04
145 0.06
146 0.08
147 0.09
148 0.11
149 0.12
150 0.16
151 0.24
152 0.34
153 0.42
154 0.51
155 0.59
156 0.68
157 0.74
158 0.79
159 0.8
160 0.8
161 0.79
162 0.79
163 0.8
164 0.77
165 0.71
166 0.64
167 0.55
168 0.45
169 0.38
170 0.34
171 0.32
172 0.32
173 0.39
174 0.45
175 0.53
176 0.56
177 0.57
178 0.55
179 0.58
180 0.59
181 0.62
182 0.67
183 0.69
184 0.77
185 0.82
186 0.8
187 0.72
188 0.68
189 0.66
190 0.64
191 0.61
192 0.6
193 0.57
194 0.57
195 0.56
196 0.5
197 0.41
198 0.32
199 0.27
200 0.18
201 0.13
202 0.12
203 0.12
204 0.16
205 0.19
206 0.22
207 0.2
208 0.19
209 0.21
210 0.25
211 0.28
212 0.3
213 0.31
214 0.33
215 0.34
216 0.38
217 0.37
218 0.33
219 0.31
220 0.27
221 0.24
222 0.22
223 0.26
224 0.25
225 0.31
226 0.34
227 0.43