Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BH87

Protein Details
Accession A0A0H1BH87    Localization Confidence High Confidence Score 19.2
NoLS Segment(s)
PositionSequenceProtein Nature
155-177EAPNSRKRARPAKKVSKPVRPAPHydrophilic
233-254DDEPPPKSKRRKSSEPSQQEKSHydrophilic
NLS Segment(s)
PositionSequence
90-127KEKKKMSSPAAPKPVPPPKPKAPKRASSASQPARKRRR
159-181SRKRARPAKKVSKPVRPAPKPKP
238-268PKSKRRKSSEPSQQEKSKKSSKPASGASRKS
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037647  HIRIP3  
Amino Acid Sequences MSDSDSDSDSLSSAGIPSDDVLEKGLRDTVAAIFKKGNLEQLTVKRVRATTEKALTLDEGFYKNDEVWKAKSDRIIKQEAEKQEELAAEKEKKKMSSPAAPKPVPPPKPKAPKRASSASQPARKRRRTATPSESEEDLSSPPSEESEEEEEEDEEAPNSRKRARPAKKVSKPVRPAPKPKPALETDTSSDLSDVPDESEKASERASSRETSPMRKPSDTKHDESESDMSVVIDDEPPPKSKRRKSSEPSQQEKSKKSSKPASGASRKSKDAADEDPDLAEIKKLQGQLVKCGIRKMWFRELAPYDTPRAKVKHLRQMLKDAGMEGRFSLEKAKAIREARELQADLEVVREGAKRWGTKVSDEEEAGNGARPRRRVARGFQALSFLEDEDGEETD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.1
6 0.11
7 0.11
8 0.13
9 0.13
10 0.13
11 0.14
12 0.16
13 0.13
14 0.12
15 0.14
16 0.16
17 0.24
18 0.24
19 0.25
20 0.24
21 0.26
22 0.31
23 0.3
24 0.33
25 0.26
26 0.29
27 0.35
28 0.39
29 0.46
30 0.44
31 0.45
32 0.41
33 0.4
34 0.41
35 0.41
36 0.41
37 0.42
38 0.45
39 0.46
40 0.43
41 0.43
42 0.39
43 0.34
44 0.28
45 0.22
46 0.18
47 0.16
48 0.16
49 0.16
50 0.16
51 0.19
52 0.21
53 0.21
54 0.22
55 0.29
56 0.31
57 0.33
58 0.39
59 0.42
60 0.46
61 0.49
62 0.53
63 0.47
64 0.52
65 0.56
66 0.55
67 0.55
68 0.48
69 0.43
70 0.39
71 0.38
72 0.32
73 0.27
74 0.28
75 0.27
76 0.3
77 0.35
78 0.36
79 0.36
80 0.38
81 0.43
82 0.43
83 0.46
84 0.52
85 0.56
86 0.62
87 0.61
88 0.6
89 0.62
90 0.64
91 0.63
92 0.6
93 0.59
94 0.6
95 0.7
96 0.76
97 0.78
98 0.76
99 0.76
100 0.76
101 0.77
102 0.7
103 0.67
104 0.69
105 0.67
106 0.68
107 0.67
108 0.7
109 0.72
110 0.76
111 0.73
112 0.7
113 0.72
114 0.71
115 0.74
116 0.72
117 0.7
118 0.69
119 0.66
120 0.6
121 0.5
122 0.43
123 0.34
124 0.25
125 0.18
126 0.13
127 0.1
128 0.09
129 0.09
130 0.09
131 0.08
132 0.12
133 0.14
134 0.15
135 0.15
136 0.15
137 0.15
138 0.15
139 0.15
140 0.11
141 0.07
142 0.08
143 0.1
144 0.11
145 0.13
146 0.17
147 0.21
148 0.28
149 0.39
150 0.46
151 0.55
152 0.64
153 0.73
154 0.77
155 0.84
156 0.85
157 0.83
158 0.81
159 0.79
160 0.78
161 0.75
162 0.76
163 0.74
164 0.76
165 0.71
166 0.66
167 0.63
168 0.55
169 0.53
170 0.46
171 0.41
172 0.33
173 0.31
174 0.29
175 0.23
176 0.21
177 0.15
178 0.13
179 0.1
180 0.08
181 0.06
182 0.06
183 0.06
184 0.07
185 0.08
186 0.08
187 0.08
188 0.09
189 0.1
190 0.1
191 0.13
192 0.15
193 0.15
194 0.16
195 0.23
196 0.25
197 0.28
198 0.33
199 0.38
200 0.4
201 0.41
202 0.42
203 0.4
204 0.49
205 0.49
206 0.46
207 0.43
208 0.41
209 0.39
210 0.4
211 0.36
212 0.26
213 0.21
214 0.18
215 0.13
216 0.1
217 0.1
218 0.08
219 0.06
220 0.06
221 0.08
222 0.09
223 0.12
224 0.15
225 0.22
226 0.31
227 0.39
228 0.48
229 0.55
230 0.65
231 0.69
232 0.77
233 0.81
234 0.82
235 0.8
236 0.78
237 0.77
238 0.73
239 0.71
240 0.67
241 0.65
242 0.59
243 0.6
244 0.62
245 0.6
246 0.6
247 0.63
248 0.66
249 0.66
250 0.7
251 0.71
252 0.66
253 0.62
254 0.57
255 0.5
256 0.43
257 0.38
258 0.34
259 0.29
260 0.27
261 0.26
262 0.24
263 0.23
264 0.21
265 0.17
266 0.13
267 0.09
268 0.08
269 0.11
270 0.12
271 0.14
272 0.17
273 0.19
274 0.24
275 0.32
276 0.35
277 0.33
278 0.35
279 0.35
280 0.37
281 0.42
282 0.43
283 0.44
284 0.44
285 0.44
286 0.5
287 0.52
288 0.5
289 0.49
290 0.44
291 0.4
292 0.38
293 0.4
294 0.37
295 0.36
296 0.38
297 0.43
298 0.5
299 0.55
300 0.61
301 0.66
302 0.64
303 0.7
304 0.67
305 0.61
306 0.53
307 0.44
308 0.39
309 0.32
310 0.29
311 0.2
312 0.19
313 0.15
314 0.15
315 0.18
316 0.15
317 0.19
318 0.21
319 0.24
320 0.29
321 0.32
322 0.36
323 0.38
324 0.42
325 0.41
326 0.44
327 0.41
328 0.34
329 0.33
330 0.3
331 0.23
332 0.19
333 0.16
334 0.1
335 0.11
336 0.11
337 0.11
338 0.17
339 0.22
340 0.23
341 0.25
342 0.33
343 0.33
344 0.37
345 0.42
346 0.39
347 0.38
348 0.37
349 0.36
350 0.29
351 0.29
352 0.24
353 0.24
354 0.23
355 0.24
356 0.28
357 0.29
358 0.35
359 0.42
360 0.5
361 0.52
362 0.58
363 0.63
364 0.69
365 0.7
366 0.64
367 0.61
368 0.53
369 0.48
370 0.41
371 0.3
372 0.2
373 0.17
374 0.17