Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BH04

Protein Details
Accession A0A0H1BH04    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-30VALSSITRRIQKHRRRRIDLYVQRNKVHydrophilic
91-121AVLRAPRKERRERRRELKRRIRKFEKVARQTBasic
NLS Segment(s)
PositionSequence
94-116RAPRKERRERRRELKRRIRKFEK
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
Amino Acid Sequences MTSVALSSITRRIQKHRRRRIDLYVQRNKVLRERKTADMVLAQRRKREDETFMGKIARANVRLRKLREVQLQLEKGFTNGKPFLMANQAVAVLRAPRKERRERRRELKRRIRKFEKVARQTGLAMMDTCQYVVQPRGVAVRRVQRRHGNMCCYRHRDNEMSSSSVAGSDTCQLPSALVSNIKLELVKKEEGGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.75
4 0.8
5 0.83
6 0.87
7 0.87
8 0.88
9 0.87
10 0.87
11 0.86
12 0.78
13 0.74
14 0.7
15 0.62
16 0.6
17 0.59
18 0.54
19 0.53
20 0.54
21 0.55
22 0.57
23 0.55
24 0.48
25 0.45
26 0.45
27 0.45
28 0.48
29 0.45
30 0.44
31 0.47
32 0.5
33 0.48
34 0.47
35 0.42
36 0.43
37 0.48
38 0.45
39 0.44
40 0.4
41 0.35
42 0.33
43 0.32
44 0.27
45 0.24
46 0.27
47 0.32
48 0.4
49 0.46
50 0.47
51 0.5
52 0.51
53 0.54
54 0.56
55 0.54
56 0.51
57 0.53
58 0.52
59 0.45
60 0.41
61 0.34
62 0.27
63 0.25
64 0.2
65 0.17
66 0.15
67 0.15
68 0.15
69 0.15
70 0.15
71 0.17
72 0.17
73 0.12
74 0.11
75 0.12
76 0.1
77 0.1
78 0.09
79 0.07
80 0.09
81 0.11
82 0.14
83 0.21
84 0.28
85 0.39
86 0.49
87 0.57
88 0.66
89 0.73
90 0.8
91 0.85
92 0.88
93 0.89
94 0.9
95 0.9
96 0.9
97 0.91
98 0.89
99 0.85
100 0.84
101 0.83
102 0.82
103 0.78
104 0.73
105 0.64
106 0.57
107 0.49
108 0.41
109 0.33
110 0.22
111 0.15
112 0.11
113 0.1
114 0.09
115 0.09
116 0.07
117 0.06
118 0.08
119 0.09
120 0.1
121 0.09
122 0.1
123 0.17
124 0.19
125 0.21
126 0.24
127 0.32
128 0.4
129 0.44
130 0.5
131 0.52
132 0.58
133 0.65
134 0.67
135 0.67
136 0.67
137 0.7
138 0.72
139 0.7
140 0.68
141 0.64
142 0.63
143 0.58
144 0.54
145 0.54
146 0.48
147 0.44
148 0.39
149 0.34
150 0.28
151 0.23
152 0.2
153 0.12
154 0.1
155 0.11
156 0.12
157 0.12
158 0.13
159 0.12
160 0.12
161 0.13
162 0.14
163 0.13
164 0.15
165 0.15
166 0.16
167 0.17
168 0.17
169 0.18
170 0.17
171 0.2
172 0.22
173 0.23
174 0.22