Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BGR2

Protein Details
Accession A0A0H1BGR2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-64GMVMGKRKRGIKRRCRCLCRWMLVHydrophilic
NLS Segment(s)
PositionSequence
46-53KRKRGIKR
Subcellular Location(s) nucl 10, mito 9, cyto 6.5, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MGRIGVGRERGGEGGRSWPMMDGRIWRVMSGNRRLWMLGMGMVMGKRKRGIKRRCRCLCRWMLVVALGLGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.19
4 0.17
5 0.18
6 0.17
7 0.17
8 0.17
9 0.16
10 0.18
11 0.23
12 0.23
13 0.21
14 0.22
15 0.25
16 0.3
17 0.34
18 0.34
19 0.3
20 0.3
21 0.3
22 0.28
23 0.24
24 0.17
25 0.11
26 0.07
27 0.06
28 0.06
29 0.07
30 0.1
31 0.09
32 0.1
33 0.13
34 0.2
35 0.29
36 0.39
37 0.49
38 0.57
39 0.68
40 0.78
41 0.85
42 0.86
43 0.83
44 0.84
45 0.82
46 0.77
47 0.7
48 0.6
49 0.52
50 0.45
51 0.4
52 0.3