Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B2WIJ5

Protein Details
Accession B2WIJ5    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
108-131VHAGHVRKEKDENKRTKKRARRRGBasic
NLS Segment(s)
PositionSequence
114-131RKEKDENKRTKKRARRRG
Subcellular Location(s) nucl 18, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000571  Znf_CCCH  
Gene Ontology GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MLEERVAKVKEQYDALLEQTVGLMGDKVKHLKDAEKKLVPKPRKHPVVCIYCCMRNLPCDRGTPCRNCAKAMHDCKRAMCANFKTGICRNKLCNRAHEEDAKHYGNIVHAGHVRKEKDENKRTKKRARRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.18
5 0.15
6 0.13
7 0.12
8 0.08
9 0.07
10 0.06
11 0.05
12 0.07
13 0.1
14 0.13
15 0.13
16 0.17
17 0.18
18 0.25
19 0.34
20 0.41
21 0.47
22 0.51
23 0.55
24 0.59
25 0.67
26 0.68
27 0.67
28 0.67
29 0.68
30 0.72
31 0.69
32 0.69
33 0.68
34 0.71
35 0.64
36 0.6
37 0.53
38 0.45
39 0.45
40 0.39
41 0.3
42 0.26
43 0.28
44 0.27
45 0.26
46 0.28
47 0.3
48 0.35
49 0.4
50 0.38
51 0.39
52 0.42
53 0.41
54 0.38
55 0.38
56 0.36
57 0.4
58 0.46
59 0.49
60 0.48
61 0.48
62 0.47
63 0.5
64 0.47
65 0.4
66 0.37
67 0.32
68 0.3
69 0.33
70 0.33
71 0.33
72 0.36
73 0.4
74 0.36
75 0.37
76 0.4
77 0.44
78 0.52
79 0.5
80 0.52
81 0.54
82 0.55
83 0.56
84 0.56
85 0.51
86 0.48
87 0.52
88 0.45
89 0.38
90 0.33
91 0.3
92 0.24
93 0.25
94 0.2
95 0.17
96 0.2
97 0.23
98 0.27
99 0.33
100 0.33
101 0.32
102 0.41
103 0.45
104 0.52
105 0.6
106 0.66
107 0.71
108 0.8
109 0.87
110 0.89
111 0.92