Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1B733

Protein Details
Accession A0A0H1B733    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
77-105DGATRPPKPWKTPKSQSVKRQRVCYRSRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MQNTGPFSAVPVGAHEGDSNYSVPDCQLPSYAPVLARCGHDLPALLQVLGDKASDITAARTLTGPWTSHQLCSASWDGATRPPKPWKTPKSQSVKRQRVCYRSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.13
4 0.14
5 0.15
6 0.13
7 0.1
8 0.1
9 0.09
10 0.1
11 0.11
12 0.11
13 0.1
14 0.11
15 0.11
16 0.13
17 0.15
18 0.15
19 0.14
20 0.14
21 0.16
22 0.16
23 0.17
24 0.17
25 0.16
26 0.15
27 0.14
28 0.14
29 0.13
30 0.15
31 0.14
32 0.11
33 0.1
34 0.09
35 0.09
36 0.09
37 0.08
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.11
51 0.11
52 0.1
53 0.17
54 0.17
55 0.18
56 0.19
57 0.19
58 0.17
59 0.2
60 0.22
61 0.15
62 0.15
63 0.15
64 0.14
65 0.2
66 0.25
67 0.23
68 0.28
69 0.37
70 0.43
71 0.51
72 0.61
73 0.62
74 0.68
75 0.76
76 0.79
77 0.81
78 0.84
79 0.86
80 0.86
81 0.88
82 0.85
83 0.86
84 0.85
85 0.84