Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BGM9

Protein Details
Accession A0A0H1BGM9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-39GSQFCQRTHKAQRTREKHHHRKKTTRKAVAAVHydrophilic
NLS Segment(s)
PositionSequence
19-34QRTREKHHHRKKTTRK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MQASQSNGSQFCQRTHKAQRTREKHHHRKKTTRKAVAAVFSINLPVDQGEPTHNCMNLVDNYNSPPRHPIST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.5
3 0.59
4 0.61
5 0.69
6 0.75
7 0.76
8 0.83
9 0.85
10 0.86
11 0.87
12 0.89
13 0.9
14 0.88
15 0.9
16 0.92
17 0.92
18 0.91
19 0.88
20 0.8
21 0.73
22 0.67
23 0.59
24 0.48
25 0.37
26 0.27
27 0.19
28 0.16
29 0.12
30 0.08
31 0.06
32 0.05
33 0.05
34 0.05
35 0.06
36 0.09
37 0.11
38 0.16
39 0.18
40 0.18
41 0.18
42 0.18
43 0.21
44 0.21
45 0.24
46 0.22
47 0.21
48 0.25
49 0.32
50 0.32
51 0.29
52 0.32