Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BG48

Protein Details
Accession A0A0H1BG48    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-47KAFHRALPRRNRRLIQRKLKRPGQRSBasic
74-105EAIIRCCSKNRPTNRKRRSHIKLKNDHYCRSRHydrophilic
NLS Segment(s)
PositionSequence
18-46NRISKAFHRALPRRNRRLIQRKLKRPGQR
89-90KR
Subcellular Location(s) mito 19.5, mito_nucl 14, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MTSSLVLVISTLVSYRRNRISKAFHRALPRRNRRLIQRKLKRPGQRSMGPAQWMQMGSRLRKYRRWSNWLPWEEAIIRCCSKNRPTNRKRRSHIKLKNDHYCRSRSSSMQKMKQLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.22
3 0.31
4 0.35
5 0.38
6 0.45
7 0.53
8 0.57
9 0.65
10 0.64
11 0.59
12 0.66
13 0.7
14 0.72
15 0.73
16 0.74
17 0.73
18 0.75
19 0.76
20 0.77
21 0.8
22 0.81
23 0.81
24 0.81
25 0.82
26 0.84
27 0.87
28 0.85
29 0.8
30 0.77
31 0.74
32 0.68
33 0.63
34 0.58
35 0.53
36 0.46
37 0.4
38 0.33
39 0.26
40 0.21
41 0.17
42 0.18
43 0.17
44 0.17
45 0.23
46 0.28
47 0.29
48 0.35
49 0.42
50 0.47
51 0.52
52 0.59
53 0.58
54 0.62
55 0.69
56 0.66
57 0.62
58 0.52
59 0.47
60 0.4
61 0.36
62 0.28
63 0.22
64 0.2
65 0.18
66 0.2
67 0.23
68 0.3
69 0.36
70 0.46
71 0.54
72 0.63
73 0.73
74 0.82
75 0.86
76 0.86
77 0.88
78 0.87
79 0.87
80 0.87
81 0.87
82 0.87
83 0.86
84 0.89
85 0.84
86 0.82
87 0.76
88 0.71
89 0.65
90 0.62
91 0.58
92 0.55
93 0.58
94 0.6
95 0.65
96 0.69