Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BDH1

Protein Details
Accession A0A0H1BDH1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-30IREKTQKSITMKKQQQKKIENKTAEKKTEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MIREKTQKSITMKKQQQKKIENKTAEKKTEIEILFKFYICSMIKNIEKTALLSEYINLLITETKSEKVDQKMLAFEEQINLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.82
4 0.82
5 0.82
6 0.82
7 0.82
8 0.82
9 0.81
10 0.83
11 0.81
12 0.74
13 0.66
14 0.56
15 0.48
16 0.48
17 0.4
18 0.33
19 0.26
20 0.27
21 0.26
22 0.24
23 0.22
24 0.14
25 0.19
26 0.15
27 0.16
28 0.12
29 0.17
30 0.18
31 0.2
32 0.2
33 0.17
34 0.17
35 0.16
36 0.17
37 0.13
38 0.12
39 0.1
40 0.1
41 0.09
42 0.09
43 0.09
44 0.07
45 0.07
46 0.07
47 0.07
48 0.11
49 0.11
50 0.13
51 0.14
52 0.17
53 0.22
54 0.26
55 0.31
56 0.31
57 0.32
58 0.34
59 0.35
60 0.34
61 0.3
62 0.26