Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BB54

Protein Details
Accession A0A0H1BB54    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-67ESLLIRRRKLRWNHCRGNSKRRRDKSVFVRSNHydrophilic
NLS Segment(s)
PositionSequence
41-58RRRKLRWNHCRGNSKRRR
Subcellular Location(s) mito 18.5, mito_nucl 13.333, nucl 7, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MSTRHITKLASRPSKLPLLRLRLVLRRSTRRLLPVESLLIRRRKLRWNHCRGNSKRRRDKSVFVRSNCKMLKNADCMMNTSSASANGCRTRRTVFDKKSSRNNSRNLKPESRASMLVKLTWRNWIATAFDISSWLSLRRRKMNSTTVSESQPSVLTIWSELIAGRNSSIFPQTMKHRGSVISRSMRRTRRIPWPLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.55
3 0.55
4 0.52
5 0.52
6 0.53
7 0.55
8 0.56
9 0.54
10 0.56
11 0.56
12 0.56
13 0.57
14 0.6
15 0.61
16 0.6
17 0.6
18 0.6
19 0.56
20 0.52
21 0.46
22 0.45
23 0.42
24 0.42
25 0.41
26 0.42
27 0.41
28 0.41
29 0.43
30 0.47
31 0.55
32 0.61
33 0.65
34 0.7
35 0.78
36 0.82
37 0.88
38 0.86
39 0.87
40 0.86
41 0.86
42 0.86
43 0.83
44 0.83
45 0.78
46 0.8
47 0.79
48 0.81
49 0.78
50 0.71
51 0.73
52 0.64
53 0.67
54 0.59
55 0.51
56 0.42
57 0.38
58 0.41
59 0.37
60 0.38
61 0.34
62 0.32
63 0.32
64 0.3
65 0.27
66 0.21
67 0.17
68 0.14
69 0.11
70 0.11
71 0.1
72 0.12
73 0.16
74 0.17
75 0.17
76 0.19
77 0.2
78 0.24
79 0.32
80 0.38
81 0.39
82 0.48
83 0.55
84 0.58
85 0.66
86 0.7
87 0.7
88 0.67
89 0.7
90 0.69
91 0.68
92 0.71
93 0.68
94 0.64
95 0.58
96 0.55
97 0.52
98 0.45
99 0.42
100 0.35
101 0.33
102 0.29
103 0.29
104 0.27
105 0.24
106 0.22
107 0.24
108 0.23
109 0.19
110 0.2
111 0.19
112 0.18
113 0.16
114 0.17
115 0.12
116 0.11
117 0.11
118 0.1
119 0.1
120 0.09
121 0.11
122 0.15
123 0.19
124 0.25
125 0.33
126 0.37
127 0.42
128 0.48
129 0.54
130 0.55
131 0.58
132 0.59
133 0.53
134 0.52
135 0.47
136 0.41
137 0.33
138 0.27
139 0.2
140 0.14
141 0.12
142 0.1
143 0.09
144 0.09
145 0.08
146 0.08
147 0.08
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.11
154 0.12
155 0.14
156 0.12
157 0.12
158 0.17
159 0.24
160 0.31
161 0.32
162 0.33
163 0.33
164 0.35
165 0.4
166 0.42
167 0.44
168 0.46
169 0.49
170 0.55
171 0.63
172 0.67
173 0.68
174 0.68
175 0.67
176 0.68
177 0.72