Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B809

Protein Details
Accession A0A0H1B809    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MRKTKNPKMRQTVTPNRIPPHydrophilic
98-144AELRVSKKESVRKWRQPRKPANEKLNASRSLRSWRNRRRLRRSVCIEHydrophilic
NLS Segment(s)
PositionSequence
104-139KKESVRKWRQPRKPANEKLNASRSLRSWRNRRRLRR
Subcellular Location(s) nucl 17.5, mito_nucl 13.499, cyto_nucl 11.666, mito 7
Family & Domain DBs
Amino Acid Sequences MRKTKNPKMRQTVTPNRIPPRQVAINGNASRSPLLSITPSWIRLESRRIPMKNSFATSLWRMSSLSLRKERKLTGGKLSEERRSSSTYNLWPMLSALAELRVSKKESVRKWRQPRKPANEKLNASRSLRSWRNRRRLRRSVCIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.75
4 0.73
5 0.66
6 0.59
7 0.56
8 0.53
9 0.49
10 0.45
11 0.43
12 0.47
13 0.46
14 0.44
15 0.37
16 0.33
17 0.29
18 0.24
19 0.21
20 0.11
21 0.11
22 0.11
23 0.11
24 0.15
25 0.17
26 0.18
27 0.18
28 0.19
29 0.2
30 0.21
31 0.28
32 0.29
33 0.36
34 0.42
35 0.42
36 0.46
37 0.49
38 0.52
39 0.49
40 0.45
41 0.38
42 0.31
43 0.33
44 0.31
45 0.27
46 0.21
47 0.18
48 0.16
49 0.14
50 0.2
51 0.2
52 0.25
53 0.31
54 0.34
55 0.35
56 0.38
57 0.38
58 0.4
59 0.42
60 0.38
61 0.37
62 0.39
63 0.39
64 0.42
65 0.44
66 0.42
67 0.37
68 0.36
69 0.31
70 0.3
71 0.29
72 0.26
73 0.28
74 0.26
75 0.28
76 0.27
77 0.25
78 0.21
79 0.2
80 0.18
81 0.13
82 0.1
83 0.06
84 0.06
85 0.07
86 0.07
87 0.09
88 0.11
89 0.13
90 0.16
91 0.22
92 0.28
93 0.36
94 0.47
95 0.56
96 0.65
97 0.74
98 0.82
99 0.86
100 0.89
101 0.91
102 0.91
103 0.91
104 0.9
105 0.89
106 0.88
107 0.84
108 0.82
109 0.78
110 0.73
111 0.65
112 0.58
113 0.52
114 0.52
115 0.55
116 0.56
117 0.59
118 0.64
119 0.73
120 0.8
121 0.87
122 0.88
123 0.91
124 0.91