Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BF22

Protein Details
Accession A0A0H1BF22    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
31-62IPLNHTRRRNRLQLRRQRRRLLPKNNPPLPPRHydrophilic
NLS Segment(s)
PositionSequence
37-63RRRNRLQLRRQRRRLLPKNNPPLPPRH
Subcellular Location(s) nucl 13, mito 11, plas 2
Family & Domain DBs
Amino Acid Sequences MQQQHANRRLQLAALHRQPKPCFFFFFFLAIPLNHTRRRNRLQLRRQRRRLLPKNNPPLPPRHPHPLLSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.45
4 0.51
5 0.52
6 0.54
7 0.54
8 0.47
9 0.44
10 0.4
11 0.41
12 0.36
13 0.36
14 0.29
15 0.24
16 0.23
17 0.17
18 0.17
19 0.18
20 0.2
21 0.23
22 0.28
23 0.31
24 0.38
25 0.43
26 0.5
27 0.56
28 0.63
29 0.69
30 0.75
31 0.83
32 0.86
33 0.89
34 0.88
35 0.88
36 0.88
37 0.88
38 0.88
39 0.88
40 0.88
41 0.9
42 0.87
43 0.84
44 0.76
45 0.74
46 0.69
47 0.67
48 0.62
49 0.61
50 0.58
51 0.58