Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BLQ6

Protein Details
Accession A0A0H1BLQ6    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
4-29ETRDTGSKRKRVSKACDRCRGKKYRCBasic
NLS Segment(s)
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR020448  Maltose_ferment_reg_DNA-bd  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MDHETRDTGSKRKRVSKACDRCRGKKYRCDGQRPACMACRESGHDCSYDPTAKKRGLPEGYVRGLEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.78
4 0.8
5 0.83
6 0.85
7 0.83
8 0.83
9 0.83
10 0.84
11 0.79
12 0.76
13 0.74
14 0.73
15 0.74
16 0.74
17 0.74
18 0.72
19 0.72
20 0.66
21 0.61
22 0.56
23 0.49
24 0.4
25 0.33
26 0.27
27 0.23
28 0.24
29 0.25
30 0.22
31 0.22
32 0.21
33 0.22
34 0.24
35 0.25
36 0.24
37 0.26
38 0.3
39 0.32
40 0.36
41 0.38
42 0.43
43 0.42
44 0.45
45 0.47
46 0.49
47 0.5
48 0.49