Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BQ56

Protein Details
Accession A0A0H1BQ56    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-77ILRPLPPPSRKGRRRRIHSRSYKAFRKRGCSSBasic
NLS Segment(s)
PositionSequence
43-73RTRILRPLPPPSRKGRRRRIHSRSYKAFRKR
Subcellular Location(s) mito 10.5, nucl 9.5, cyto_mito 7.833, cyto_nucl 7.333, cyto 4
Family & Domain DBs
Amino Acid Sequences MRTCFINSNSNCAQSWMLNLVNSIWLICTRSFCLNGLMHPRVRTRILRPLPPPSRKGRRRRIHSRSYKAFRKRGCSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.2
4 0.19
5 0.16
6 0.16
7 0.14
8 0.14
9 0.13
10 0.1
11 0.07
12 0.07
13 0.08
14 0.09
15 0.1
16 0.11
17 0.13
18 0.14
19 0.14
20 0.18
21 0.16
22 0.18
23 0.23
24 0.24
25 0.23
26 0.24
27 0.25
28 0.23
29 0.26
30 0.28
31 0.25
32 0.33
33 0.36
34 0.41
35 0.44
36 0.52
37 0.57
38 0.59
39 0.6
40 0.6
41 0.66
42 0.69
43 0.76
44 0.76
45 0.78
46 0.83
47 0.89
48 0.89
49 0.89
50 0.9
51 0.9
52 0.9
53 0.89
54 0.89
55 0.88
56 0.87
57 0.82