Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BBH3

Protein Details
Accession A0A0H1BBH3   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
111-130GGAGRSKKAKTTKERLRLIDHydrophilic
NLS Segment(s)
PositionSequence
31-49KKGAGRKGATAATAGGKRK
99-125SKSRRGGRGGGSGGAGRSKKAKTTKER
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, cyto 4.5, mito 3
Family & Domain DBs
Amino Acid Sequences MWLADDNQAEMIEQLEKEAMDKAEEMGTTGKKGAGRKGATAATAGGKRKRDVTLDDMYHEGEGHFEDASAKPSGAATPVSAGDNNNNTTSLTAGGAAGSKSRRGGRGGGSGGAGRSKKAKTTKERLRLIDGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.12
6 0.12
7 0.11
8 0.11
9 0.12
10 0.12
11 0.12
12 0.13
13 0.14
14 0.14
15 0.14
16 0.14
17 0.15
18 0.17
19 0.19
20 0.23
21 0.28
22 0.29
23 0.3
24 0.33
25 0.32
26 0.29
27 0.27
28 0.23
29 0.18
30 0.2
31 0.23
32 0.23
33 0.25
34 0.25
35 0.28
36 0.29
37 0.28
38 0.28
39 0.3
40 0.32
41 0.3
42 0.3
43 0.28
44 0.26
45 0.23
46 0.19
47 0.13
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.06
54 0.06
55 0.09
56 0.09
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.05
64 0.06
65 0.07
66 0.08
67 0.08
68 0.09
69 0.11
70 0.13
71 0.15
72 0.14
73 0.14
74 0.13
75 0.13
76 0.13
77 0.11
78 0.08
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.09
85 0.09
86 0.1
87 0.14
88 0.17
89 0.19
90 0.21
91 0.24
92 0.26
93 0.32
94 0.33
95 0.3
96 0.28
97 0.27
98 0.25
99 0.27
100 0.23
101 0.17
102 0.21
103 0.21
104 0.28
105 0.36
106 0.45
107 0.5
108 0.61
109 0.7
110 0.75
111 0.82
112 0.78
113 0.77