Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B772

Protein Details
Accession A0A0H1B772   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73VLSISSSKMRQKQRSRTLAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, plas 8, mito_nucl 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLNPSSRRRGGRMLSCLLVYRVRVKQRHVRNWLGIIRLVVSEQLLFAQILSVLVLSISSSKMRQKQRSRTLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.44
4 0.38
5 0.31
6 0.24
7 0.24
8 0.26
9 0.33
10 0.35
11 0.4
12 0.47
13 0.55
14 0.63
15 0.64
16 0.62
17 0.57
18 0.6
19 0.56
20 0.48
21 0.39
22 0.29
23 0.23
24 0.18
25 0.15
26 0.09
27 0.07
28 0.05
29 0.04
30 0.04
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.04
44 0.05
45 0.07
46 0.1
47 0.17
48 0.25
49 0.36
50 0.46
51 0.56
52 0.65
53 0.75