Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BEF8

Protein Details
Accession A0A0H1BEF8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRRRRCSCSRSGRMRRVPVRFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, plas 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MRRRRCSCSRSGRMRRVPVRFLVVCVESPLAAGLRTILDERPRRGLNLWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.81
4 0.74
5 0.65
6 0.62
7 0.52
8 0.44
9 0.36
10 0.29
11 0.23
12 0.2
13 0.17
14 0.1
15 0.09
16 0.09
17 0.06
18 0.05
19 0.05
20 0.05
21 0.05
22 0.06
23 0.07
24 0.09
25 0.18
26 0.24
27 0.27
28 0.34
29 0.36
30 0.37