Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BE44

Protein Details
Accession A0A0H1BE44    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
73-92MKNREKKKSGWRFKKTGSSGBasic
NLS Segment(s)
PositionSequence
76-86REKKKSGWRFK
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 8, cyto 3.5, extr 2
Family & Domain DBs
Amino Acid Sequences MSLTSNMNGNGMGMPQPYHLPRVATEGSNVVGGLRPVSGLRASTNATMNGGQGGKDEDHHDDEEEEAAWAEMMKNREKKKSGWRFKKTGSSGLGLGDLFTGSGRTNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.15
4 0.15
5 0.18
6 0.18
7 0.18
8 0.18
9 0.24
10 0.25
11 0.21
12 0.21
13 0.19
14 0.19
15 0.17
16 0.16
17 0.1
18 0.09
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.07
25 0.07
26 0.07
27 0.08
28 0.09
29 0.11
30 0.12
31 0.14
32 0.12
33 0.13
34 0.13
35 0.12
36 0.12
37 0.1
38 0.08
39 0.07
40 0.08
41 0.07
42 0.08
43 0.1
44 0.1
45 0.12
46 0.13
47 0.13
48 0.12
49 0.12
50 0.11
51 0.1
52 0.08
53 0.06
54 0.05
55 0.04
56 0.04
57 0.05
58 0.07
59 0.1
60 0.16
61 0.23
62 0.28
63 0.35
64 0.38
65 0.44
66 0.52
67 0.61
68 0.66
69 0.7
70 0.74
71 0.75
72 0.78
73 0.82
74 0.75
75 0.71
76 0.63
77 0.55
78 0.47
79 0.4
80 0.35
81 0.25
82 0.21
83 0.14
84 0.1
85 0.07
86 0.07
87 0.07
88 0.06