Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1B5K0

Protein Details
Accession A0A0H1B5K0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
79-98DDTPTKKPRARKPKAAKSEEBasic
NLS Segment(s)
PositionSequence
83-95TKKPRARKPKAAK
Subcellular Location(s) cyto 9.5, cyto_nucl 8.5, nucl 6.5, E.R. 4, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MVNWDAAADRALLLNVIDPVAKPNWERVAASMGDGFTAEACRQHFRKLKTEALGEGSPAATTSTPTKTKRKANEPNGTDDTPTKKPRARKPKAAKSEELKAELPTYNTDSDVKKEASIKNEAVIEEATSMDHEFETANLTVLMFLLAQLVNFAKYIVSSWRFEANGGVYIGSEGHIFRIQSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.11
7 0.12
8 0.15
9 0.14
10 0.19
11 0.24
12 0.26
13 0.26
14 0.25
15 0.28
16 0.25
17 0.26
18 0.21
19 0.16
20 0.14
21 0.13
22 0.12
23 0.07
24 0.09
25 0.08
26 0.09
27 0.11
28 0.17
29 0.18
30 0.27
31 0.33
32 0.36
33 0.45
34 0.48
35 0.53
36 0.51
37 0.52
38 0.45
39 0.43
40 0.38
41 0.3
42 0.24
43 0.18
44 0.13
45 0.11
46 0.11
47 0.05
48 0.07
49 0.09
50 0.14
51 0.2
52 0.24
53 0.32
54 0.38
55 0.46
56 0.53
57 0.61
58 0.67
59 0.71
60 0.76
61 0.7
62 0.71
63 0.68
64 0.6
65 0.5
66 0.42
67 0.37
68 0.34
69 0.34
70 0.31
71 0.3
72 0.38
73 0.47
74 0.56
75 0.58
76 0.63
77 0.71
78 0.77
79 0.83
80 0.8
81 0.75
82 0.68
83 0.68
84 0.59
85 0.52
86 0.42
87 0.32
88 0.29
89 0.25
90 0.22
91 0.16
92 0.16
93 0.13
94 0.13
95 0.15
96 0.14
97 0.16
98 0.18
99 0.17
100 0.17
101 0.21
102 0.23
103 0.24
104 0.28
105 0.26
106 0.24
107 0.25
108 0.24
109 0.2
110 0.17
111 0.14
112 0.1
113 0.09
114 0.07
115 0.07
116 0.07
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.08
123 0.08
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.06
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.06
142 0.08
143 0.14
144 0.17
145 0.18
146 0.21
147 0.25
148 0.26
149 0.26
150 0.27
151 0.22
152 0.22
153 0.21
154 0.19
155 0.14
156 0.14
157 0.14
158 0.11
159 0.1
160 0.07
161 0.09
162 0.12
163 0.12