Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BNN6

Protein Details
Accession A0A0H1BNN6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22GRRRRRRRRGGKTRQQLHSRISBasic
NLS Segment(s)
PositionSequence
2-15RRRRRRRRGGKTRQ
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences GRRRRRRRRGGKTRQQLHSRISKSINKTKEDRVSELTAEGKEGEATNTSLVLFRVPSPPPPVLFCSLLLSVSSSYHSIQRSHFAHLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.82
4 0.77
5 0.75
6 0.67
7 0.61
8 0.57
9 0.55
10 0.55
11 0.58
12 0.58
13 0.53
14 0.54
15 0.57
16 0.59
17 0.56
18 0.51
19 0.47
20 0.44
21 0.39
22 0.36
23 0.3
24 0.22
25 0.18
26 0.15
27 0.1
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.11
42 0.12
43 0.14
44 0.18
45 0.2
46 0.21
47 0.23
48 0.25
49 0.25
50 0.26
51 0.24
52 0.23
53 0.21
54 0.2
55 0.18
56 0.16
57 0.13
58 0.12
59 0.13
60 0.11
61 0.12
62 0.16
63 0.18
64 0.19
65 0.21
66 0.29
67 0.3