Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BII7

Protein Details
Accession A0A0H1BII7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
26-56VNNTQNFNKKNKKNKKKDKNSEEKNKNFNKLHydrophilic
NLS Segment(s)
PositionSequence
34-51KKNKKNKKKDKNSEEKNK
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
Amino Acid Sequences MRLYYNILFRLLIADEISVSDRKILVNNTQNFNKKNKKNKKKDKNSEEKNKNFNKLERRDNNMIKMCYHCQKIDHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.11
5 0.09
6 0.09
7 0.09
8 0.09
9 0.1
10 0.12
11 0.14
12 0.19
13 0.27
14 0.31
15 0.35
16 0.4
17 0.45
18 0.45
19 0.51
20 0.54
21 0.53
22 0.6
23 0.67
24 0.72
25 0.78
26 0.87
27 0.9
28 0.92
29 0.94
30 0.94
31 0.94
32 0.93
33 0.93
34 0.92
35 0.88
36 0.87
37 0.82
38 0.78
39 0.72
40 0.68
41 0.67
42 0.65
43 0.68
44 0.66
45 0.68
46 0.7
47 0.7
48 0.72
49 0.69
50 0.63
51 0.55
52 0.54
53 0.52
54 0.5
55 0.49
56 0.43