Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BDA2

Protein Details
Accession A0A0H1BDA2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-86PETAATATKKPKRKPSRSPAAKISLRRHydrophilic
NLS Segment(s)
PositionSequence
68-99KKPKRKPSRSPAAKISLRRVAVEAQRSKDGMR
Subcellular Location(s) mito 9, cyto 7.5, cyto_nucl 7.5, nucl 6.5, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003734  DUF155  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF02582  DUF155  
Amino Acid Sequences MFARCFLSSVCRTPRIKPVLSRFEHTFHPSCPTKSLQWRKEFYSSKIDLQHAKSETPPEPETAATATKKPKRKPSRSPAAKISLRRVAVEAQRSKDGMRKKTPIADEDLAKSKTVTAYAVAETFNVAKVVQILLAKGYEPDPFKTDLYPQVVHVQVPLDSLRRTSSPSASNLPPDEAGDIFIFPSGTVVAWALPDSFASYLATSLLLPAAENPHVDSMETEDLDYIEDPNRENSTIKGDTITLGTKISPDNRDSWADGKEGVDNVLTKIAFSSGLARSTKLAVLETLLSNYFESTRNIPTLLSKGTRLPFTRRFVLQKTGQLLSVRAQLNLYSELTDSLPDLFWDSRHELGLEGYYDQVGRALDVGIRIKVLNEKMDYAQEIASVLRERLSETHGLRLEWIIIALIAVEVGFEILRLWKEKKQHELEAMESTEQTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.62
4 0.63
5 0.66
6 0.68
7 0.7
8 0.7
9 0.64
10 0.59
11 0.58
12 0.56
13 0.49
14 0.4
15 0.45
16 0.44
17 0.42
18 0.43
19 0.42
20 0.44
21 0.51
22 0.61
23 0.62
24 0.66
25 0.69
26 0.7
27 0.75
28 0.72
29 0.66
30 0.65
31 0.59
32 0.56
33 0.57
34 0.56
35 0.53
36 0.51
37 0.54
38 0.46
39 0.45
40 0.41
41 0.41
42 0.41
43 0.4
44 0.37
45 0.31
46 0.31
47 0.29
48 0.28
49 0.24
50 0.26
51 0.22
52 0.26
53 0.34
54 0.4
55 0.49
56 0.55
57 0.64
58 0.7
59 0.78
60 0.84
61 0.85
62 0.89
63 0.9
64 0.89
65 0.87
66 0.85
67 0.81
68 0.75
69 0.72
70 0.67
71 0.58
72 0.52
73 0.45
74 0.41
75 0.41
76 0.45
77 0.43
78 0.39
79 0.41
80 0.41
81 0.4
82 0.39
83 0.42
84 0.41
85 0.44
86 0.46
87 0.48
88 0.55
89 0.57
90 0.55
91 0.54
92 0.48
93 0.42
94 0.41
95 0.43
96 0.36
97 0.33
98 0.3
99 0.23
100 0.21
101 0.19
102 0.16
103 0.1
104 0.12
105 0.12
106 0.13
107 0.12
108 0.11
109 0.11
110 0.11
111 0.09
112 0.08
113 0.07
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.11
126 0.13
127 0.14
128 0.16
129 0.18
130 0.19
131 0.19
132 0.21
133 0.23
134 0.26
135 0.25
136 0.24
137 0.26
138 0.26
139 0.25
140 0.23
141 0.18
142 0.13
143 0.14
144 0.14
145 0.11
146 0.1
147 0.11
148 0.12
149 0.12
150 0.15
151 0.16
152 0.2
153 0.21
154 0.24
155 0.28
156 0.27
157 0.29
158 0.27
159 0.26
160 0.22
161 0.19
162 0.17
163 0.12
164 0.12
165 0.09
166 0.08
167 0.07
168 0.07
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.05
185 0.06
186 0.05
187 0.05
188 0.06
189 0.06
190 0.05
191 0.05
192 0.05
193 0.04
194 0.04
195 0.04
196 0.06
197 0.06
198 0.06
199 0.07
200 0.08
201 0.08
202 0.08
203 0.07
204 0.09
205 0.09
206 0.09
207 0.09
208 0.08
209 0.08
210 0.08
211 0.08
212 0.06
213 0.07
214 0.07
215 0.08
216 0.1
217 0.11
218 0.11
219 0.12
220 0.12
221 0.16
222 0.16
223 0.16
224 0.15
225 0.14
226 0.14
227 0.14
228 0.14
229 0.08
230 0.08
231 0.08
232 0.08
233 0.1
234 0.13
235 0.14
236 0.15
237 0.17
238 0.2
239 0.22
240 0.22
241 0.23
242 0.21
243 0.18
244 0.18
245 0.16
246 0.14
247 0.13
248 0.11
249 0.1
250 0.09
251 0.08
252 0.1
253 0.09
254 0.08
255 0.08
256 0.08
257 0.07
258 0.07
259 0.11
260 0.1
261 0.15
262 0.15
263 0.15
264 0.16
265 0.17
266 0.18
267 0.14
268 0.13
269 0.09
270 0.1
271 0.11
272 0.1
273 0.1
274 0.09
275 0.09
276 0.09
277 0.09
278 0.1
279 0.1
280 0.11
281 0.13
282 0.15
283 0.16
284 0.16
285 0.16
286 0.16
287 0.18
288 0.2
289 0.18
290 0.17
291 0.22
292 0.24
293 0.29
294 0.3
295 0.34
296 0.39
297 0.43
298 0.46
299 0.45
300 0.48
301 0.47
302 0.52
303 0.49
304 0.46
305 0.45
306 0.41
307 0.39
308 0.35
309 0.32
310 0.27
311 0.29
312 0.24
313 0.21
314 0.2
315 0.18
316 0.19
317 0.21
318 0.19
319 0.12
320 0.12
321 0.13
322 0.13
323 0.12
324 0.1
325 0.09
326 0.08
327 0.08
328 0.11
329 0.1
330 0.1
331 0.15
332 0.18
333 0.18
334 0.19
335 0.19
336 0.16
337 0.16
338 0.18
339 0.14
340 0.11
341 0.1
342 0.1
343 0.1
344 0.09
345 0.1
346 0.08
347 0.07
348 0.07
349 0.07
350 0.08
351 0.11
352 0.14
353 0.12
354 0.13
355 0.13
356 0.14
357 0.19
358 0.21
359 0.22
360 0.22
361 0.24
362 0.25
363 0.28
364 0.28
365 0.24
366 0.21
367 0.16
368 0.15
369 0.13
370 0.14
371 0.13
372 0.12
373 0.12
374 0.12
375 0.14
376 0.16
377 0.2
378 0.24
379 0.24
380 0.32
381 0.32
382 0.32
383 0.31
384 0.3
385 0.27
386 0.2
387 0.19
388 0.1
389 0.08
390 0.08
391 0.07
392 0.05
393 0.04
394 0.03
395 0.03
396 0.03
397 0.03
398 0.03
399 0.03
400 0.04
401 0.07
402 0.1
403 0.15
404 0.19
405 0.24
406 0.33
407 0.41
408 0.51
409 0.56
410 0.61
411 0.64
412 0.64
413 0.63
414 0.6
415 0.55
416 0.46
417 0.38