Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BB53

Protein Details
Accession A0A0H1BB53    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-81IPPGNRQSRRRRHFLKTQPNKHWRNQAHydrophilic
NLS Segment(s)
PositionSequence
56-67PPGNRQSRRRRH
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MPTGWGNIQESHACPNIPNPGKGRQKGVLSGSYRRSNCQSGPRSRWPPQPGRSEIPPGNRQSRRRRHFLKTQPNKHWRNQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.29
4 0.3
5 0.32
6 0.32
7 0.39
8 0.48
9 0.5
10 0.51
11 0.46
12 0.45
13 0.45
14 0.45
15 0.42
16 0.36
17 0.39
18 0.4
19 0.42
20 0.4
21 0.39
22 0.39
23 0.35
24 0.35
25 0.39
26 0.41
27 0.42
28 0.48
29 0.54
30 0.58
31 0.6
32 0.65
33 0.63
34 0.64
35 0.63
36 0.64
37 0.61
38 0.58
39 0.57
40 0.56
41 0.52
42 0.51
43 0.5
44 0.48
45 0.52
46 0.55
47 0.61
48 0.65
49 0.72
50 0.72
51 0.76
52 0.78
53 0.76
54 0.8
55 0.82
56 0.82
57 0.83
58 0.86
59 0.87
60 0.9
61 0.88