Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B705

Protein Details
Accession A0A0H1B705    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-52GWAERVREAKRQGRKLKKERRKRKAKGKKAAAIAEBasic
112-131REFMRTEKKLQERKRIRMAEBasic
NLS Segment(s)
PositionSequence
24-49REAKRQGRKLKKERRKRKAKGKKAAA
Subcellular Location(s) nucl 17, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019180  Oxidoreductase-like_N  
IPR039251  OXLD1  
Pfam View protein in Pfam  
PF09791  Oxidored-like  
Amino Acid Sequences MSGCVHCVWDDYRDDVEGWAERVREAKRQGRKLKKERRKRKAKGKKAAAIAEKAGDSVAVGEIGHKPRKEVESASLSMDDDGGGSEVNWTGGNGNGIGDLDDLFADIPVGIREFMRTEKKLQERKRIRMAEAETGSGGGDGHRASV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.21
4 0.18
5 0.18
6 0.17
7 0.16
8 0.15
9 0.2
10 0.22
11 0.26
12 0.33
13 0.39
14 0.47
15 0.57
16 0.67
17 0.72
18 0.81
19 0.85
20 0.88
21 0.91
22 0.92
23 0.93
24 0.94
25 0.94
26 0.93
27 0.94
28 0.94
29 0.94
30 0.94
31 0.92
32 0.88
33 0.83
34 0.8
35 0.71
36 0.62
37 0.52
38 0.42
39 0.32
40 0.25
41 0.18
42 0.11
43 0.07
44 0.05
45 0.05
46 0.04
47 0.03
48 0.04
49 0.08
50 0.12
51 0.16
52 0.15
53 0.16
54 0.18
55 0.2
56 0.21
57 0.19
58 0.2
59 0.21
60 0.22
61 0.22
62 0.2
63 0.18
64 0.16
65 0.15
66 0.1
67 0.05
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.05
97 0.05
98 0.05
99 0.07
100 0.08
101 0.14
102 0.21
103 0.23
104 0.27
105 0.36
106 0.46
107 0.54
108 0.61
109 0.67
110 0.7
111 0.77
112 0.83
113 0.79
114 0.71
115 0.7
116 0.66
117 0.64
118 0.56
119 0.49
120 0.38
121 0.34
122 0.31
123 0.22
124 0.18
125 0.08
126 0.08