Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BQV3

Protein Details
Accession A0A0H1BQV3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-59GPKRWFLRVRRSRLRRGRCWBasic
NLS Segment(s)
PositionSequence
42-55KRWFLRVRRSRLRR
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MDRQIPCPHLPRRAGSRIAVGKNVLPSSALCRTHGRQLPGPKRWFLRVRRSRLRRGRCWSAQGPAHASYANDVCAAGTEAGCRYLPSHVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.51
3 0.53
4 0.52
5 0.5
6 0.46
7 0.38
8 0.34
9 0.34
10 0.32
11 0.23
12 0.16
13 0.15
14 0.18
15 0.23
16 0.22
17 0.21
18 0.26
19 0.27
20 0.35
21 0.39
22 0.37
23 0.36
24 0.45
25 0.52
26 0.55
27 0.56
28 0.51
29 0.49
30 0.52
31 0.54
32 0.5
33 0.53
34 0.53
35 0.6
36 0.67
37 0.72
38 0.76
39 0.78
40 0.81
41 0.79
42 0.78
43 0.78
44 0.72
45 0.73
46 0.65
47 0.62
48 0.56
49 0.49
50 0.45
51 0.37
52 0.34
53 0.27
54 0.24
55 0.2
56 0.18
57 0.16
58 0.12
59 0.1
60 0.09
61 0.09
62 0.11
63 0.09
64 0.08
65 0.09
66 0.09
67 0.11
68 0.12
69 0.11
70 0.11