Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B2U8

Protein Details
Accession A0A0H1B2U8   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
81-100GGRRREKREGEKERERERERBasic
110-133RDGYRDRDRSRDRDRDRGRSRRDRBasic
NLS Segment(s)
PositionSequence
81-133GGRRREKREGEKERERERERERESDRAGDRDGYRDRDRSRDRDRDRGRSRRDR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MRKRLVGELEEELKGGGGDSRRGQYGARDGERVGGAKKQFKTYQVHELAEAKIEESERLRKALGIRGEGEQGDEWRWGGDGGRRREKREGEKERERERERERESDRAGDRDGYRDRDRSRDRDRDRGRSRRDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.14
3 0.11
4 0.09
5 0.13
6 0.16
7 0.18
8 0.19
9 0.2
10 0.2
11 0.22
12 0.28
13 0.32
14 0.31
15 0.3
16 0.29
17 0.31
18 0.32
19 0.29
20 0.22
21 0.19
22 0.21
23 0.27
24 0.29
25 0.32
26 0.33
27 0.37
28 0.42
29 0.42
30 0.47
31 0.45
32 0.43
33 0.39
34 0.39
35 0.34
36 0.29
37 0.25
38 0.15
39 0.11
40 0.11
41 0.1
42 0.1
43 0.15
44 0.14
45 0.15
46 0.15
47 0.16
48 0.17
49 0.22
50 0.22
51 0.18
52 0.19
53 0.19
54 0.19
55 0.18
56 0.17
57 0.12
58 0.1
59 0.09
60 0.08
61 0.07
62 0.06
63 0.07
64 0.06
65 0.07
66 0.11
67 0.17
68 0.24
69 0.35
70 0.37
71 0.41
72 0.48
73 0.54
74 0.6
75 0.63
76 0.66
77 0.65
78 0.73
79 0.78
80 0.79
81 0.83
82 0.76
83 0.74
84 0.71
85 0.72
86 0.67
87 0.68
88 0.64
89 0.62
90 0.61
91 0.61
92 0.56
93 0.49
94 0.45
95 0.42
96 0.38
97 0.37
98 0.39
99 0.38
100 0.4
101 0.44
102 0.45
103 0.5
104 0.57
105 0.59
106 0.64
107 0.68
108 0.71
109 0.74
110 0.8
111 0.81
112 0.84
113 0.85