Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BH78

Protein Details
Accession A0A0H1BH78   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
74-125QCCIETKDKPKDPKPKPKPKPKPKPKPKDPKKPKKPKKPKKPTKTVGQKILABasic
NLS Segment(s)
PositionSequence
81-117DKPKDPKPKPKPKPKPKPKPKDPKKPKKPKKPKKPTK
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000064  NLP_P60_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF00877  NLPC_P60  
PROSITE View protein in PROSITE  
PS51935  NLPC_P60  
Amino Acid Sequences MDGMGTCMARSKCTGVYYDGACGRNSGETRCCVQVKCKVGGRSGECQNVKRSKCKGGKFHVGSSNTCPAGKDVQCCIETKDKPKDPKPKPKPKPKPKPKPKDPKKPKKPKKPKKPTKTVGQKILALAMKEKGTKYVWGGGSCKGPTKGGYDCSGLVAYAVCKVTKRNLFSEGLRVTYSMYCASSSRLGKFKKIPFSKRRAGDAVFFGSSCSCKNQNISHMGLMINSGDRMVHAPNPRTVVKEGKVSQQGSLKACPYVIRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.3
4 0.29
5 0.33
6 0.34
7 0.32
8 0.3
9 0.28
10 0.25
11 0.27
12 0.27
13 0.26
14 0.25
15 0.27
16 0.3
17 0.36
18 0.38
19 0.34
20 0.39
21 0.43
22 0.44
23 0.48
24 0.51
25 0.48
26 0.5
27 0.56
28 0.53
29 0.53
30 0.53
31 0.54
32 0.51
33 0.51
34 0.55
35 0.56
36 0.55
37 0.56
38 0.56
39 0.57
40 0.62
41 0.67
42 0.68
43 0.67
44 0.75
45 0.7
46 0.72
47 0.7
48 0.64
49 0.58
50 0.54
51 0.52
52 0.42
53 0.38
54 0.31
55 0.25
56 0.3
57 0.3
58 0.28
59 0.25
60 0.28
61 0.29
62 0.29
63 0.31
64 0.32
65 0.34
66 0.38
67 0.46
68 0.48
69 0.56
70 0.64
71 0.71
72 0.72
73 0.8
74 0.83
75 0.84
76 0.87
77 0.91
78 0.93
79 0.94
80 0.95
81 0.95
82 0.95
83 0.95
84 0.96
85 0.96
86 0.96
87 0.95
88 0.95
89 0.95
90 0.95
91 0.95
92 0.96
93 0.95
94 0.96
95 0.96
96 0.96
97 0.96
98 0.96
99 0.96
100 0.95
101 0.95
102 0.91
103 0.9
104 0.9
105 0.85
106 0.82
107 0.73
108 0.63
109 0.52
110 0.49
111 0.4
112 0.29
113 0.23
114 0.16
115 0.14
116 0.14
117 0.14
118 0.12
119 0.12
120 0.13
121 0.13
122 0.18
123 0.18
124 0.19
125 0.2
126 0.2
127 0.22
128 0.21
129 0.22
130 0.17
131 0.16
132 0.15
133 0.17
134 0.18
135 0.17
136 0.19
137 0.18
138 0.17
139 0.17
140 0.16
141 0.13
142 0.11
143 0.08
144 0.06
145 0.07
146 0.08
147 0.07
148 0.08
149 0.09
150 0.16
151 0.22
152 0.25
153 0.25
154 0.29
155 0.31
156 0.32
157 0.38
158 0.32
159 0.28
160 0.25
161 0.23
162 0.2
163 0.18
164 0.18
165 0.11
166 0.11
167 0.1
168 0.1
169 0.13
170 0.17
171 0.19
172 0.22
173 0.28
174 0.29
175 0.34
176 0.42
177 0.46
178 0.51
179 0.58
180 0.64
181 0.66
182 0.73
183 0.76
184 0.73
185 0.72
186 0.66
187 0.59
188 0.53
189 0.47
190 0.42
191 0.34
192 0.29
193 0.24
194 0.2
195 0.19
196 0.16
197 0.18
198 0.16
199 0.18
200 0.24
201 0.28
202 0.34
203 0.38
204 0.4
205 0.36
206 0.35
207 0.32
208 0.27
209 0.23
210 0.17
211 0.12
212 0.09
213 0.08
214 0.06
215 0.07
216 0.09
217 0.11
218 0.16
219 0.23
220 0.26
221 0.3
222 0.35
223 0.36
224 0.38
225 0.4
226 0.41
227 0.37
228 0.43
229 0.42
230 0.46
231 0.52
232 0.49
233 0.5
234 0.48
235 0.5
236 0.45
237 0.47
238 0.4
239 0.34
240 0.34
241 0.33