Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BJ40

Protein Details
Accession A0A0H1BJ40    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-39WLNRRVPLRNSRSRLNKRKRRMRIPRSWRKTCKPRLTSHydrophilic
NLS Segment(s)
PositionSequence
9-35LRNSRSRLNKRKRRMRIPRSWRKTCKP
Subcellular Location(s) nucl 18, mito_nucl 14.166, cyto_nucl 10.666, mito 8
Family & Domain DBs
Amino Acid Sequences MWLNRRVPLRNSRSRLNKRKRRMRIPRSWRKTCKPRLTSAMMKRRVDISRAWKTATKALSPSGDDSVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.84
4 0.85
5 0.85
6 0.91
7 0.92
8 0.92
9 0.92
10 0.92
11 0.92
12 0.92
13 0.93
14 0.92
15 0.91
16 0.88
17 0.87
18 0.87
19 0.86
20 0.85
21 0.78
22 0.73
23 0.69
24 0.68
25 0.67
26 0.66
27 0.65
28 0.62
29 0.59
30 0.55
31 0.54
32 0.49
33 0.42
34 0.39
35 0.39
36 0.41
37 0.42
38 0.44
39 0.42
40 0.43
41 0.47
42 0.44
43 0.38
44 0.31
45 0.33
46 0.34
47 0.32
48 0.33