Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BGL8

Protein Details
Accession A0A0H1BGL8   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-57TRPMTPLQRRPPRKIPPKPSSHydrophilic
NLS Segment(s)
PositionSequence
48-50PRK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MSTVVAVMRTATPMAPTHLANPPPLPSNNSNSNSNNTRPMTPLQRRPPRKIPPKPSSAHYVRVASVARNTSSATTDHSIPKTNRLNVTSVARSFPAATTSPNTPAHMGVARLSWVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.19
5 0.25
6 0.26
7 0.26
8 0.26
9 0.24
10 0.26
11 0.27
12 0.29
13 0.27
14 0.31
15 0.38
16 0.4
17 0.43
18 0.41
19 0.46
20 0.44
21 0.43
22 0.44
23 0.37
24 0.35
25 0.32
26 0.34
27 0.38
28 0.41
29 0.48
30 0.51
31 0.6
32 0.65
33 0.7
34 0.76
35 0.76
36 0.8
37 0.8
38 0.8
39 0.77
40 0.78
41 0.72
42 0.65
43 0.63
44 0.55
45 0.5
46 0.42
47 0.37
48 0.29
49 0.3
50 0.27
51 0.2
52 0.2
53 0.16
54 0.14
55 0.13
56 0.14
57 0.12
58 0.13
59 0.12
60 0.14
61 0.14
62 0.16
63 0.19
64 0.2
65 0.26
66 0.25
67 0.33
68 0.37
69 0.4
70 0.42
71 0.4
72 0.41
73 0.38
74 0.43
75 0.39
76 0.33
77 0.3
78 0.26
79 0.25
80 0.24
81 0.2
82 0.18
83 0.14
84 0.16
85 0.18
86 0.2
87 0.25
88 0.26
89 0.28
90 0.25
91 0.25
92 0.26
93 0.25
94 0.23
95 0.19
96 0.18