Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BDC7

Protein Details
Accession A0A0H1BDC7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
46-68GNEPWKGKREKRRKKADLVRIGGBasic
81-111GVKVKRNSARNSNNRKKRERLKIDLPNRFCYHydrophilic
NLS Segment(s)
PositionSequence
22-31RRMARRRFLG
33-34GK
41-61PGQRIGNEPWKGKREKRRKKA
82-101VKVKRNSARNSNNRKKRERL
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MILRRVRRFLPWVGIVPPRLLRRMARRRFLGMGKIGMSIAPGQRIGNEPWKGKREKRRKKADLVRIGGLYLSLRTGNRSLGVKVKRNSARNSNNRKKRERLKIDLPNRFCYGTCRSLCKGYRLRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.39
3 0.37
4 0.38
5 0.34
6 0.32
7 0.32
8 0.34
9 0.4
10 0.5
11 0.56
12 0.58
13 0.59
14 0.61
15 0.63
16 0.6
17 0.56
18 0.48
19 0.41
20 0.34
21 0.31
22 0.26
23 0.21
24 0.18
25 0.14
26 0.11
27 0.1
28 0.09
29 0.09
30 0.1
31 0.13
32 0.15
33 0.21
34 0.24
35 0.26
36 0.31
37 0.37
38 0.41
39 0.46
40 0.54
41 0.58
42 0.65
43 0.72
44 0.78
45 0.78
46 0.83
47 0.86
48 0.85
49 0.83
50 0.75
51 0.66
52 0.55
53 0.49
54 0.38
55 0.28
56 0.18
57 0.09
58 0.06
59 0.06
60 0.06
61 0.08
62 0.09
63 0.09
64 0.11
65 0.13
66 0.14
67 0.2
68 0.26
69 0.32
70 0.33
71 0.42
72 0.47
73 0.51
74 0.56
75 0.58
76 0.63
77 0.66
78 0.75
79 0.77
80 0.8
81 0.83
82 0.85
83 0.84
84 0.84
85 0.85
86 0.83
87 0.81
88 0.82
89 0.84
90 0.86
91 0.86
92 0.81
93 0.75
94 0.68
95 0.6
96 0.5
97 0.45
98 0.42
99 0.41
100 0.39
101 0.41
102 0.41
103 0.49
104 0.52
105 0.56