Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B5W0

Protein Details
Accession A0A0H1B5W0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
85-111RSERSVKPANNWKRRRKLPDYNDRASWHydrophilic
NLS Segment(s)
PositionSequence
91-101KPANNWKRRRK
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MQLQTMAWRQTMRSKRLQGGERVWVADVDLLRYRLTGPFRRCSFLRIPPLRKGTVALPWMQWKQMMRKKDSDHPTITDSWPSLRRSERSVKPANNWKRRRKLPDYNDRASWKKHYSPLIHSVTMLMIRSQGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.56
3 0.64
4 0.67
5 0.65
6 0.61
7 0.62
8 0.54
9 0.49
10 0.42
11 0.33
12 0.28
13 0.23
14 0.18
15 0.13
16 0.14
17 0.14
18 0.14
19 0.14
20 0.15
21 0.16
22 0.22
23 0.27
24 0.3
25 0.38
26 0.4
27 0.44
28 0.43
29 0.45
30 0.45
31 0.45
32 0.5
33 0.5
34 0.53
35 0.56
36 0.6
37 0.56
38 0.5
39 0.43
40 0.34
41 0.31
42 0.28
43 0.22
44 0.19
45 0.22
46 0.22
47 0.21
48 0.21
49 0.17
50 0.25
51 0.29
52 0.33
53 0.32
54 0.37
55 0.41
56 0.48
57 0.52
58 0.48
59 0.45
60 0.42
61 0.41
62 0.38
63 0.35
64 0.27
65 0.22
66 0.2
67 0.22
68 0.21
69 0.22
70 0.24
71 0.25
72 0.3
73 0.39
74 0.42
75 0.45
76 0.53
77 0.52
78 0.56
79 0.65
80 0.7
81 0.71
82 0.75
83 0.77
84 0.79
85 0.84
86 0.86
87 0.85
88 0.86
89 0.86
90 0.87
91 0.85
92 0.8
93 0.78
94 0.74
95 0.68
96 0.62
97 0.59
98 0.54
99 0.52
100 0.53
101 0.55
102 0.54
103 0.57
104 0.61
105 0.6
106 0.53
107 0.47
108 0.41
109 0.35
110 0.31
111 0.26
112 0.17
113 0.12