Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BHL1

Protein Details
Accession A0A0H1BHL1    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKSEKKSEKKSEKKLKTELKQEFKQBasic
NLS Segment(s)
PositionSequence
5-14KKSEKKSEKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKSEKKSEKKSEKKLKTELKQEFKQESEIELKQESETEDEKQFKTEDKLKQDSEYELESQSESEIEYKSDCKLKLNLKSEFKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.85
4 0.85
5 0.84
6 0.82
7 0.78
8 0.75
9 0.69
10 0.6
11 0.55
12 0.45
13 0.38
14 0.34
15 0.3
16 0.25
17 0.22
18 0.21
19 0.17
20 0.17
21 0.15
22 0.13
23 0.13
24 0.14
25 0.17
26 0.19
27 0.19
28 0.19
29 0.19
30 0.17
31 0.2
32 0.25
33 0.27
34 0.32
35 0.37
36 0.36
37 0.38
38 0.38
39 0.35
40 0.3
41 0.27
42 0.21
43 0.17
44 0.16
45 0.14
46 0.13
47 0.12
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.1
54 0.11
55 0.14
56 0.19
57 0.19
58 0.22
59 0.29
60 0.37
61 0.45
62 0.52
63 0.58
64 0.6