Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BAM3

Protein Details
Accession A0A0H1BAM3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-43AAEPPIPHPRKLQRRRQKRQRKSLISTVQPSHydrophilic
NLS Segment(s)
PositionSequence
11-34KRAAEPPIPHPRKLQRRRQKRQRK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MKCDQWAPSAKRAAEPPIPHPRKLQRRRQKRQRKSLISTVQPSDDRQLPNDFPSPYRLKERQQQQQLFPSPPLSAIMAALNKIAANSPSRQNPSELETSLAGALSDLETNTPDLKAALRPLQFVSAREVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.45
3 0.45
4 0.5
5 0.53
6 0.51
7 0.56
8 0.6
9 0.64
10 0.7
11 0.73
12 0.73
13 0.8
14 0.9
15 0.93
16 0.94
17 0.94
18 0.95
19 0.95
20 0.94
21 0.9
22 0.88
23 0.85
24 0.8
25 0.74
26 0.64
27 0.57
28 0.48
29 0.42
30 0.36
31 0.32
32 0.27
33 0.24
34 0.27
35 0.24
36 0.26
37 0.29
38 0.26
39 0.21
40 0.27
41 0.27
42 0.26
43 0.32
44 0.33
45 0.33
46 0.4
47 0.47
48 0.5
49 0.57
50 0.58
51 0.54
52 0.58
53 0.56
54 0.5
55 0.43
56 0.35
57 0.25
58 0.21
59 0.19
60 0.12
61 0.09
62 0.08
63 0.09
64 0.08
65 0.08
66 0.07
67 0.07
68 0.06
69 0.06
70 0.06
71 0.06
72 0.08
73 0.11
74 0.15
75 0.21
76 0.25
77 0.26
78 0.27
79 0.28
80 0.3
81 0.31
82 0.27
83 0.24
84 0.2
85 0.2
86 0.18
87 0.16
88 0.11
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.06
96 0.08
97 0.09
98 0.09
99 0.08
100 0.08
101 0.1
102 0.13
103 0.17
104 0.23
105 0.23
106 0.25
107 0.26
108 0.33
109 0.33
110 0.31
111 0.34