Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1BH72

Protein Details
Accession A0A0H1BH72    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
247-271PTTPGGGKERIKRRKSKISSATVASHydrophilic
NLS Segment(s)
PositionSequence
238-263KAGRGGEKSPTTPGGGKERIKRRKSK
Subcellular Location(s) mito 12, extr 9, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007018  Mediator_Med6  
IPR038566  Mediator_Med6_sf  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF04934  Med6  
Amino Acid Sequences MRKKRAGVGSGAAGGDDEIQVLATYFIVGDSVFMAPSVLKVVGSRMLSTVTSLTRALSVASPLPIFSPSYGHTYMPPVPKSLEASRPGVQQSGQQSIANTPMPDASSQSKGGSVLSATAATQQPSTSPPPLTSSSTTTQDSRSLVEAFNLLSRYGDEYMDDAPLLGEPGSFIIGKTSTEPLVVGMRQPMGSKVSKAPTPAPSAGAGAGLSKPGTPAATGAAAAPPAIKTDAATLGAGKAGRGGEKSPTTPGGGKERIKRRKSKISSATVASLAAGSSAGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.1
4 0.07
5 0.05
6 0.05
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.08
25 0.07
26 0.07
27 0.07
28 0.1
29 0.14
30 0.15
31 0.15
32 0.14
33 0.15
34 0.15
35 0.16
36 0.16
37 0.12
38 0.13
39 0.13
40 0.13
41 0.12
42 0.12
43 0.12
44 0.1
45 0.11
46 0.1
47 0.12
48 0.11
49 0.11
50 0.12
51 0.12
52 0.12
53 0.1
54 0.11
55 0.12
56 0.17
57 0.18
58 0.18
59 0.18
60 0.22
61 0.27
62 0.31
63 0.3
64 0.26
65 0.26
66 0.27
67 0.31
68 0.31
69 0.31
70 0.28
71 0.32
72 0.33
73 0.34
74 0.34
75 0.29
76 0.26
77 0.23
78 0.24
79 0.23
80 0.23
81 0.21
82 0.2
83 0.2
84 0.23
85 0.2
86 0.16
87 0.12
88 0.11
89 0.11
90 0.11
91 0.13
92 0.13
93 0.14
94 0.15
95 0.15
96 0.15
97 0.14
98 0.14
99 0.12
100 0.09
101 0.07
102 0.06
103 0.06
104 0.05
105 0.08
106 0.09
107 0.09
108 0.09
109 0.08
110 0.09
111 0.11
112 0.14
113 0.14
114 0.14
115 0.14
116 0.17
117 0.2
118 0.22
119 0.21
120 0.22
121 0.23
122 0.25
123 0.26
124 0.23
125 0.22
126 0.21
127 0.2
128 0.17
129 0.16
130 0.14
131 0.12
132 0.12
133 0.11
134 0.09
135 0.1
136 0.1
137 0.08
138 0.07
139 0.07
140 0.09
141 0.09
142 0.09
143 0.08
144 0.08
145 0.09
146 0.09
147 0.08
148 0.06
149 0.05
150 0.05
151 0.05
152 0.04
153 0.03
154 0.03
155 0.04
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.07
162 0.08
163 0.1
164 0.09
165 0.09
166 0.09
167 0.09
168 0.11
169 0.11
170 0.1
171 0.1
172 0.1
173 0.11
174 0.11
175 0.11
176 0.13
177 0.14
178 0.16
179 0.19
180 0.22
181 0.23
182 0.25
183 0.28
184 0.28
185 0.33
186 0.31
187 0.29
188 0.26
189 0.25
190 0.22
191 0.18
192 0.14
193 0.09
194 0.08
195 0.07
196 0.07
197 0.06
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.08
204 0.08
205 0.09
206 0.09
207 0.09
208 0.08
209 0.08
210 0.08
211 0.06
212 0.07
213 0.08
214 0.08
215 0.07
216 0.1
217 0.12
218 0.13
219 0.13
220 0.12
221 0.11
222 0.13
223 0.13
224 0.1
225 0.1
226 0.1
227 0.12
228 0.13
229 0.14
230 0.19
231 0.22
232 0.24
233 0.26
234 0.27
235 0.29
236 0.3
237 0.33
238 0.35
239 0.4
240 0.44
241 0.5
242 0.59
243 0.66
244 0.72
245 0.78
246 0.78
247 0.82
248 0.84
249 0.85
250 0.85
251 0.83
252 0.81
253 0.75
254 0.68
255 0.58
256 0.49
257 0.38
258 0.29
259 0.19
260 0.13
261 0.09