Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1BAN6

Protein Details
Accession A0A0H1BAN6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-106SSDDTRRPSRSRRQVQPKQEIEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038872  Put_GTT3  
Amino Acid Sequences MSPALPYLRGLRKSDLVVLAEISNLQDFEDYKKTELEAALDEHLAANRASLSGEQRLADYYRRLSQTSRSSPIKREPKPEPAMSSDDTRRPSRSRRQVQPKQEIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.31
4 0.27
5 0.25
6 0.2
7 0.17
8 0.15
9 0.12
10 0.09
11 0.07
12 0.07
13 0.06
14 0.07
15 0.11
16 0.17
17 0.17
18 0.18
19 0.18
20 0.18
21 0.19
22 0.19
23 0.16
24 0.12
25 0.12
26 0.12
27 0.11
28 0.11
29 0.09
30 0.09
31 0.08
32 0.07
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.07
39 0.08
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.13
46 0.12
47 0.13
48 0.17
49 0.19
50 0.2
51 0.2
52 0.26
53 0.34
54 0.38
55 0.42
56 0.44
57 0.46
58 0.49
59 0.58
60 0.61
61 0.57
62 0.59
63 0.58
64 0.61
65 0.65
66 0.63
67 0.57
68 0.51
69 0.51
70 0.46
71 0.46
72 0.4
73 0.39
74 0.4
75 0.4
76 0.41
77 0.42
78 0.49
79 0.54
80 0.61
81 0.65
82 0.72
83 0.8
84 0.85
85 0.9
86 0.92