Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1B969

Protein Details
Accession A0A0H1B969    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-113KQEDNERKKGDKRRNTKLQTLGFHydrophilic
NLS Segment(s)
PositionSequence
98-100KKG
102-102K
Subcellular Location(s) nucl 12.5, cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0000339  F:RNA cap binding  
GO:0006397  P:mRNA processing  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01728  LSm1  
Amino Acid Sequences MFPIEKLVLVLRDGRKLIGVLRSWDQFANLVLQGTVERLYAGNLFADLQRGIYLVRGENVLLLGEVDLDKDDDIPTGYRQAPFEEVFALKKQEDNERKKGDKRRNTKLQTLGFEAEHSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.23
4 0.25
5 0.24
6 0.23
7 0.23
8 0.26
9 0.27
10 0.27
11 0.27
12 0.24
13 0.19
14 0.17
15 0.16
16 0.13
17 0.11
18 0.1
19 0.1
20 0.09
21 0.09
22 0.09
23 0.06
24 0.06
25 0.06
26 0.07
27 0.07
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.08
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.06
62 0.07
63 0.1
64 0.12
65 0.13
66 0.14
67 0.15
68 0.18
69 0.17
70 0.17
71 0.15
72 0.15
73 0.15
74 0.17
75 0.17
76 0.14
77 0.16
78 0.18
79 0.27
80 0.36
81 0.41
82 0.49
83 0.55
84 0.61
85 0.68
86 0.75
87 0.76
88 0.76
89 0.78
90 0.8
91 0.82
92 0.83
93 0.83
94 0.82
95 0.79
96 0.73
97 0.69
98 0.61
99 0.5
100 0.44
101 0.37
102 0.29
103 0.22