Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WC55

Protein Details
Accession B2WC55    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-33SKDKVVKRPARGYHKFKNGLBasic
NLS Segment(s)
PositionSequence
14-24SKDKVVKRPAR
Subcellular Location(s) cyto_nucl 8.833, mito_nucl 8.833, mito 8.5, cyto 8.5, nucl 8
Family & Domain DBs
Amino Acid Sequences MVPRKATAANKAGSKDKVVKRPARGYHKFKNGLFNVTPKRSEKELVKVNQQSPLLRLPPEIRNRIWEFALGGMVYRVKNPDSDRHRKLAPSPKQPAGISLLRIVVRIFQCKYVKKAYEDDLRAVLEEAASGPVNVKIEHTNRHWLDYDTSFWKGSAQDTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.49
4 0.53
5 0.58
6 0.62
7 0.65
8 0.72
9 0.76
10 0.77
11 0.79
12 0.78
13 0.79
14 0.81
15 0.8
16 0.73
17 0.73
18 0.65
19 0.62
20 0.55
21 0.54
22 0.52
23 0.49
24 0.51
25 0.44
26 0.46
27 0.42
28 0.45
29 0.4
30 0.4
31 0.45
32 0.45
33 0.51
34 0.52
35 0.51
36 0.52
37 0.49
38 0.41
39 0.35
40 0.35
41 0.28
42 0.23
43 0.23
44 0.22
45 0.28
46 0.34
47 0.36
48 0.32
49 0.37
50 0.39
51 0.39
52 0.35
53 0.28
54 0.21
55 0.17
56 0.17
57 0.1
58 0.07
59 0.06
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.11
66 0.13
67 0.21
68 0.28
69 0.37
70 0.39
71 0.42
72 0.43
73 0.41
74 0.47
75 0.49
76 0.49
77 0.5
78 0.52
79 0.52
80 0.54
81 0.53
82 0.47
83 0.41
84 0.34
85 0.26
86 0.21
87 0.21
88 0.17
89 0.18
90 0.16
91 0.16
92 0.16
93 0.19
94 0.19
95 0.23
96 0.29
97 0.32
98 0.36
99 0.39
100 0.41
101 0.4
102 0.44
103 0.44
104 0.47
105 0.46
106 0.44
107 0.38
108 0.35
109 0.32
110 0.28
111 0.21
112 0.12
113 0.1
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.09
120 0.1
121 0.1
122 0.12
123 0.17
124 0.2
125 0.27
126 0.3
127 0.38
128 0.38
129 0.42
130 0.42
131 0.38
132 0.4
133 0.36
134 0.37
135 0.32
136 0.33
137 0.3
138 0.28
139 0.27
140 0.24