Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H1B2C6

Protein Details
Accession A0A0H1B2C6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-91NNIIKEFKEKKEKKNKNKKNKNNSESKTQLHydrophilic
NLS Segment(s)
PositionSequence
69-82KEKKEKKNKNKKNK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
Amino Acid Sequences RDYIQKRIKKTQNFKLTSVILNIHLLMKKIHSYLNSLKDKKNSQTLTSAVNSAQTDTVTANNNIIKEFKEKKEKKNKNKKNKNNSESKTQLAITDDSESFQMTNLTEMINMPVYFVKLHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.64
4 0.55
5 0.47
6 0.38
7 0.29
8 0.25
9 0.23
10 0.2
11 0.18
12 0.17
13 0.15
14 0.15
15 0.16
16 0.16
17 0.18
18 0.16
19 0.21
20 0.27
21 0.36
22 0.43
23 0.44
24 0.47
25 0.51
26 0.54
27 0.52
28 0.54
29 0.47
30 0.4
31 0.41
32 0.38
33 0.36
34 0.32
35 0.29
36 0.19
37 0.2
38 0.18
39 0.14
40 0.13
41 0.09
42 0.09
43 0.08
44 0.1
45 0.1
46 0.1
47 0.11
48 0.11
49 0.12
50 0.12
51 0.12
52 0.11
53 0.16
54 0.21
55 0.25
56 0.35
57 0.4
58 0.5
59 0.61
60 0.7
61 0.75
62 0.82
63 0.87
64 0.87
65 0.94
66 0.94
67 0.94
68 0.95
69 0.91
70 0.91
71 0.84
72 0.82
73 0.74
74 0.66
75 0.58
76 0.47
77 0.4
78 0.32
79 0.29
80 0.21
81 0.21
82 0.18
83 0.16
84 0.16
85 0.15
86 0.12
87 0.12
88 0.11
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.11
96 0.13
97 0.13
98 0.13
99 0.13
100 0.14