Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H1B9T2

Protein Details
Accession A0A0H1B9T2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-31APPATIRPPPPLKKRGKKSPKPTLPSSPTCHydrophilic
NLS Segment(s)
PositionSequence
8-22RPPPPLKKRGKKSPK
Subcellular Location(s) mito 21, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019808  Histidine_triad_CS  
IPR001310  Histidine_triad_HIT  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF01230  HIT  
PROSITE View protein in PROSITE  
PS00892  HIT_1  
PS51084  HIT_2  
Amino Acid Sequences MAPPATIRPPPPLKKRGKKSPKPTLPSSPTCPFCAIAAAHPPSPPSRRDVPINQSATKKDDTGAPAPQAHLILSTKHVLAFLDIMPLTRGHVLVIARGHYEKLGNVGVEVGKELGKWLPILSRVVTRTVLGTELDSRGEDPAQWNVVQNNGPRASQTVPHVHFHIIPRPALDTNTPTKGGWLMFGRGQRDELDDDEAQETVAQLRAELAREVARVKEAEGIDLDLDGEFEQSKGKRRGLEKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.89
4 0.9
5 0.91
6 0.92
7 0.94
8 0.93
9 0.9
10 0.87
11 0.86
12 0.83
13 0.79
14 0.76
15 0.72
16 0.65
17 0.6
18 0.55
19 0.45
20 0.37
21 0.34
22 0.27
23 0.22
24 0.27
25 0.27
26 0.26
27 0.26
28 0.27
29 0.29
30 0.31
31 0.3
32 0.27
33 0.31
34 0.34
35 0.41
36 0.46
37 0.48
38 0.54
39 0.57
40 0.56
41 0.53
42 0.51
43 0.48
44 0.42
45 0.35
46 0.27
47 0.26
48 0.27
49 0.27
50 0.28
51 0.26
52 0.26
53 0.26
54 0.26
55 0.22
56 0.17
57 0.15
58 0.13
59 0.11
60 0.12
61 0.13
62 0.12
63 0.12
64 0.12
65 0.1
66 0.1
67 0.1
68 0.08
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.1
75 0.09
76 0.09
77 0.06
78 0.09
79 0.09
80 0.1
81 0.11
82 0.11
83 0.11
84 0.12
85 0.12
86 0.1
87 0.1
88 0.08
89 0.09
90 0.1
91 0.08
92 0.08
93 0.09
94 0.08
95 0.08
96 0.08
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.06
105 0.06
106 0.08
107 0.09
108 0.09
109 0.12
110 0.12
111 0.14
112 0.14
113 0.13
114 0.12
115 0.11
116 0.11
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.08
125 0.08
126 0.07
127 0.08
128 0.09
129 0.1
130 0.1
131 0.11
132 0.11
133 0.13
134 0.16
135 0.16
136 0.19
137 0.19
138 0.19
139 0.18
140 0.2
141 0.19
142 0.19
143 0.22
144 0.24
145 0.26
146 0.27
147 0.29
148 0.27
149 0.29
150 0.29
151 0.32
152 0.26
153 0.23
154 0.23
155 0.24
156 0.24
157 0.22
158 0.21
159 0.19
160 0.21
161 0.24
162 0.25
163 0.22
164 0.22
165 0.22
166 0.2
167 0.2
168 0.17
169 0.16
170 0.19
171 0.22
172 0.24
173 0.23
174 0.24
175 0.21
176 0.22
177 0.21
178 0.19
179 0.21
180 0.19
181 0.2
182 0.19
183 0.18
184 0.15
185 0.13
186 0.12
187 0.08
188 0.1
189 0.09
190 0.08
191 0.1
192 0.12
193 0.13
194 0.13
195 0.14
196 0.13
197 0.15
198 0.16
199 0.15
200 0.17
201 0.16
202 0.16
203 0.21
204 0.19
205 0.19
206 0.19
207 0.19
208 0.16
209 0.16
210 0.15
211 0.09
212 0.09
213 0.07
214 0.07
215 0.06
216 0.06
217 0.12
218 0.14
219 0.24
220 0.3
221 0.35
222 0.41